Query         008894
Match_columns 549
No_of_seqs    84 out of 86
Neff          2.7 
Searched_HMMs 46136
Date          Thu Mar 28 17:54:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/008894.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/008894hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01396 MeCP2_MBD MeCP2, MBD1,  99.3 1.1E-12 2.3E-17  109.1   4.9   48   37-85      4-51  (77)
  2 PF01429 MBD:  Methyl-CpG bindi  99.3 2.8E-12 6.1E-17  105.4   4.5   50   36-86      7-57  (77)
  3 cd00122 MBD MeCP2, MBD1, MBD2,  99.2   2E-11 4.4E-16   96.7   4.5   47   38-85      4-50  (62)
  4 smart00391 MBD Methyl-CpG bind  98.9   2E-09 4.4E-14   89.6   4.5   46   40-86      8-55  (77)
  5 cd01397 HAT_MBD Methyl-CpG bin  98.7 1.4E-08 3.1E-13   84.8   4.4   58   38-96      4-64  (73)
  6 KOG4161 Methyl-CpG binding tra  98.0 4.1E-06 8.9E-11   83.9   3.2   62   36-98     15-78  (272)
  7 cd01395 HMT_MBD Methyl-CpG bin  96.6  0.0021 4.5E-08   52.5   3.3   40   42-83      8-47  (60)
  8 KOG4161 Methyl-CpG binding tra  93.6   0.021 4.6E-07   57.8   0.2   62   38-101   106-170 (272)
  9 PF01429 MBD:  Methyl-CpG bindi  93.2   0.059 1.3E-06   44.8   2.2   23    5-27      5-27  (77)
 10 cd01396 MeCP2_MBD MeCP2, MBD1,  89.8    0.26 5.7E-06   41.6   2.6   16   10-25      6-21  (77)
 11 KOG1891 Proline binding protei  89.6     0.3 6.4E-06   49.7   3.2   41    6-48     89-137 (271)
 12 cd00122 MBD MeCP2, MBD1, MBD2,  86.7    0.69 1.5E-05   37.0   3.0   19    7-25      2-20  (62)
 13 PF00397 WW:  WW domain;  Inter  76.7     1.2 2.5E-05   31.4   0.8   25   40-70      1-25  (31)
 14 smart00456 WW Domain with 2 co  67.7     4.6  0.0001   27.7   2.1   24   40-70      1-24  (32)
 15 KOG1891 Proline binding protei  62.1     3.9 8.5E-05   41.9   1.3   23   39-68     93-115 (271)
 16 PRK10984 DNA-binding transcrip  60.6     5.6 0.00012   37.3   1.9   41    2-48     46-86  (127)
 17 PF07417 Crl:  Transcriptional   58.2     7.1 0.00015   36.6   2.1   43    2-50     44-86  (125)
 18 smart00391 MBD Methyl-CpG bind  49.3      17 0.00037   30.8   2.8   18    6-25      5-22  (77)
 19 KOG3259 Peptidyl-prolyl cis-tr  44.0      12 0.00027   36.3   1.4   29   37-71      4-32  (163)
 20 PHA03165 hypothetical protein;  36.2      11 0.00023   30.8  -0.3   12  360-371    44-55  (57)
 21 PF00408 PGM_PMM_IV:  Phosphogl  35.6      35 0.00076   27.5   2.6   26   10-35     31-56  (73)
 22 cd00201 WW Two conserved trypt  30.1      44 0.00095   22.4   2.0   23   41-70      1-23  (31)
 23 PF14657 Integrase_AP2:  AP2-li  22.1      62  0.0013   24.4   1.7   21   64-84      9-36  (46)
 24 PF08265 YL1_C:  YL1 nuclear pr  21.8      52  0.0011   24.0   1.2   17   61-77     10-26  (30)

No 1  
>cd01396 MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are members of a protein family that share the methyl-CpG-binding domain (MBD). The MBD, consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1.
Probab=99.33  E-value=1.1e-12  Score=109.10  Aligned_cols=48  Identities=42%  Similarity=0.800  Sum_probs=43.5

Q ss_pred             CCCCCCCceEEEEEecCCCcccccccccCCCCCccccchHHHHHHHhhc
Q 008894           37 PDGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETG   85 (549)
Q Consensus        37 ~~~LP~GWvkE~~~Rk~G~~ir~DkYY~DPvsGykFRSkkdV~RYLeTG   85 (549)
                      .-.||.||.+|+++|++|...++|.||++| +|++|||+++|.+||+..
T Consensus         4 ~~~lp~GW~r~~~~R~~gs~~k~DvyY~sP-~Gkk~RS~~ev~~yL~~~   51 (77)
T cd01396           4 DPRLPPGWKRELVPRKSGSAGKFDVYYISP-TGKKFRSKVELARYLEKN   51 (77)
T ss_pred             CCCCCCCCEEEEEEecCCCCCcceEEEECC-CCCEEECHHHHHHHHHhC
Confidence            345999999999999999767999999999 589999999999999974


No 2  
>PF01429 MBD:  Methyl-CpG binding domain;  InterPro: IPR001739 Methylation at CpG dinucleotide, the most common DNA modification in eukaryotes, has been correlated with gene silencing associated with various phenomena such as genomic imprinting, transposon and chromosome X inactivation, differentiation, and cancer. Effects of DNA methylation are mediated through proteins which bind to symmetrically methylated CpGs. Such proteins contain a specific domain of ~70 residues, the methyl-CpG-binding domain (MBD), which is linked to additional domains associated with chromatin, such as the bromodomain, the AT hook motif,the SET domain, or the PHD finger. MBD-containing proteins appear to act as structural proteins, which recruit a variety of histone deacetylase (HDAC) complexes and chromatin remodelling factors, leading to chromatin compaction and, consequently, to transcriptional repression. The MBD of MeCP2, MBD1, MBD2, MBD4 and BAZ2 mediates binding to DNA, in case of MeCP2, MBD1 and MBD2 preferentially to methylated CpG. In case of human MBD3 and SETDB1 the MBD has been shown to mediate protein-protein interactions [, ]. The MBD folds into an alpha/beta sandwich structure comprising a layer of twisted beta sheet, backed by another layer formed by the alpha1 helix and a hairpin loop at the C terminus. These layers are both amphipathic, with the alpha1 helix and the beta sheet lying parallel and the hydrophobic faces tightly packed against each other. The beta sheet is composed of two long inner strands (beta2 and beta3) sandwiched by two shorter outer strands (beta1 and beta4) [].; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 2KY8_A 1UB1_A 1D9N_A 1IG4_A 1QK9_A 3C2I_A.
Probab=99.28  E-value=2.8e-12  Score=105.37  Aligned_cols=50  Identities=40%  Similarity=0.780  Sum_probs=44.0

Q ss_pred             CCCCCCCCceEEEEEecCCCc-ccccccccCCCCCccccchHHHHHHHhhcc
Q 008894           36 TPDGLPPGWTKEIKVTKTGRK-VRRDPYYIDPASGYIFRSMKDAVRYVETGE   86 (549)
Q Consensus        36 ~~~~LP~GWvkE~~~Rk~G~~-ir~DkYY~DPvsGykFRSkkdV~RYLeTG~   86 (549)
                      .+.+||+||.+|+++|++|.. .+.|.||++| +|++|||+++|.+||+.+.
T Consensus         7 ~~~~Lp~GW~re~~~R~~g~~~~~~dv~Y~sP-~Gk~~RS~~eV~~yL~~~~   57 (77)
T PF01429_consen    7 LDPPLPDGWKREVVVRKSGSSAGKKDVYYYSP-CGKRFRSKKEVVRYLKENP   57 (77)
T ss_dssp             EBTTSTTT-EEEEEESSSSTTTTSEEEEEEET-TSEEESSHHHHHHHHTTSS
T ss_pred             ccCCCCCCCEEEEEEecCCCcCCceEEEEECC-CCCEEeCHHHHHHHHHhCC
Confidence            456899999999999998864 5899999999 9999999999999998766


No 3  
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=99.18  E-value=2e-11  Score=96.71  Aligned_cols=47  Identities=40%  Similarity=0.834  Sum_probs=43.1

Q ss_pred             CCCCCCceEEEEEecCCCcccccccccCCCCCccccchHHHHHHHhhc
Q 008894           38 DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETG   85 (549)
Q Consensus        38 ~~LP~GWvkE~~~Rk~G~~ir~DkYY~DPvsGykFRSkkdV~RYLeTG   85 (549)
                      .+||.||.+|+++|+.|..++.|.||+.| +|++|||+.+|.+||...
T Consensus         4 ~P~p~GW~R~~~~r~~g~~~k~dv~Y~sP-~Gk~~Rs~~ev~~yL~~~   50 (62)
T cd00122           4 DPLPPGWKRELVIRKSGSAGKGDVYYYSP-CGKKLRSKPEVARYLEKT   50 (62)
T ss_pred             CCCCCCeEEEEEEcCCCCCCcceEEEECC-CCceecCHHHHHHHHHhC
Confidence            47899999999999999777999999999 599999999999999864


No 4  
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=98.87  E-value=2e-09  Score=89.60  Aligned_cols=46  Identities=43%  Similarity=0.829  Sum_probs=41.7

Q ss_pred             CCCCceEEEEEecCCC-cccccccccCCCCCccccchHHHHHHHhh-cc
Q 008894           40 LPPGWTKEIKVTKTGR-KVRRDPYYIDPASGYIFRSMKDAVRYVET-GE   86 (549)
Q Consensus        40 LP~GWvkE~~~Rk~G~-~ir~DkYY~DPvsGykFRSkkdV~RYLeT-G~   86 (549)
                      ||.||.+++++|+.|. ..+.|.||+.| +|++|||+.||.+||.. |+
T Consensus         8 lp~GW~R~~~~r~~g~~~~~~dV~Y~sP-~GkklRs~~ev~~YL~~~~~   55 (77)
T smart00391        8 LPCGWRRETKQRKSGRSAGKFDVYYISP-CGKKLRSKSELARYLHKNGD   55 (77)
T ss_pred             CCCCcEEEEEEecCCCCCCcccEEEECC-CCCeeeCHHHHHHHHHhCCC
Confidence            9999999999999984 56899999999 79999999999999974 44


No 5  
>cd01397 HAT_MBD Methyl-CpG binding domains (MBD) present in putative chromatin remodelling factor such as BAZ2A; BAZ2A contains a MBD, DDT, PHD-type zinc finger and Bromo domain suggesting that BAZ2A might be associated with histone acetyltransferase (HAT) activity. The Drosophila melanogaster toutatis protein, a putative subunit of the chromatin-remodeling complex, and other such proteins in this group share a similar domain architecture with BAZ2A, as does the Caenorhabditis elegans flectin homolog.
Probab=98.70  E-value=1.4e-08  Score=84.84  Aligned_cols=58  Identities=19%  Similarity=0.472  Sum_probs=48.4

Q ss_pred             CCCCCCceEEEEEecCCCcccccccccCCCCCccccchHHHHHHHhh---ccccceeeccCC
Q 008894           38 DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVET---GEIGRLAYKPKD   96 (549)
Q Consensus        38 ~~LP~GWvkE~~~Rk~G~~ir~DkYY~DPvsGykFRSkkdV~RYLeT---G~Isr~a~kPk~   96 (549)
                      -.||-||..|+++|+.|.+++.|.||+.| +|++|||+.||.+||..   ..+++-.|....
T Consensus         4 ~Pl~~GW~Re~vir~~~~~~~~dV~Y~aP-cGKklRs~~ev~~yL~~~~~~~Lt~dnFsF~~   64 (73)
T cd01397           4 VPLELGWRRETRIRGLGGRIQGEVAYYAP-CGKKLRQYPEVIKYLSKNGISLLSRENFSFSA   64 (73)
T ss_pred             CCCCCCceeEEEeccCCCCccceEEEECC-CCcccccHHHHHHHHHhCCccCccHhHccccC
Confidence            35899999999999998778999999999 69999999999999985   445554444443


No 6  
>KOG4161 consensus Methyl-CpG binding transcription regulators [Transcription; Chromatin structure and dynamics]
Probab=97.98  E-value=4.1e-06  Score=83.89  Aligned_cols=62  Identities=34%  Similarity=0.629  Sum_probs=51.0

Q ss_pred             CCCCCCCCceEEEEEecCCC-cccccccccCCCCCccccchHHHHHHHh-hccccceeeccCCCC
Q 008894           36 TPDGLPPGWTKEIKVTKTGR-KVRRDPYYIDPASGYIFRSMKDAVRYVE-TGEIGRLAYKPKDDG   98 (549)
Q Consensus        36 ~~~~LP~GWvkE~~~Rk~G~-~ir~DkYY~DPvsGykFRSkkdV~RYLe-TG~Isr~a~kPk~r~   98 (549)
                      .|..||+||.++++.|++|. .++.|.||+.| .|.+|||+.+..+||+ .|+.+.-.++..+..
T Consensus        15 ~c~~lp~GW~~~~~~r~~~~~~g~~dv~~~sp-~g~~frsk~~l~~~~~~~~~~s~~~~v~~k~~   78 (272)
T KOG4161|consen   15 DCPALPPGWTREEVQRSSGLSAGKSDVYYISP-SGKKFRSKPQLARYLGKVGDLSLFDFVTGKMS   78 (272)
T ss_pred             cCCCCCCCcchhhhcccCCCcccccceEEeCC-cccccccccHHHHHhccccccccCcccccccc
Confidence            67789999999999999987 55999999999 7999999999999998 455555444444433


No 7  
>cd01395 HMT_MBD Methyl-CpG binding domains (MBD) present in putative histone methyltransferases (HMT) such as CLLD8 and SETDB1 proteins; CLLD8 contains a MBD, a PreSET and a bifurcated SET domain, suggesting that CLLD8 might be associated with methylation-mediated transcriptional repression. SETDB1 and other proteins in this group have a similar domain architecture. SETDB1 is a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins.
Probab=96.58  E-value=0.0021  Score=52.51  Aligned_cols=40  Identities=28%  Similarity=0.542  Sum_probs=35.8

Q ss_pred             CCceEEEEEecCCCcccccccccCCCCCccccchHHHHHHHh
Q 008894           42 PGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVE   83 (549)
Q Consensus        42 ~GWvkE~~~Rk~G~~ir~DkYY~DPvsGykFRSkkdV~RYLe   83 (549)
                      =||......|+.| +++.+.+|.-| .|++.|++.||++||-
T Consensus         8 ~gw~R~~~~~~~~-~~k~~V~Y~aP-CGr~Lr~~~EV~~YL~   47 (60)
T cd01395           8 CGFQRMKYRARVG-KVKKHVIYKAP-CGRSLRNMSEVHRYLR   47 (60)
T ss_pred             cCeEEEEEeccCC-CcccceEEECC-cchhhhcHHHHHHHHH
Confidence            5999999888777 56889999999 6999999999999995


No 8  
>KOG4161 consensus Methyl-CpG binding transcription regulators [Transcription; Chromatin structure and dynamics]
Probab=93.61  E-value=0.021  Score=57.77  Aligned_cols=62  Identities=18%  Similarity=0.184  Sum_probs=48.2

Q ss_pred             CCCCCCceEEEEEecCCCcc-cccccc--cCCCCCccccchHHHHHHHhhccccceeeccCCCCCCC
Q 008894           38 DGLPPGWTKEIKVTKTGRKV-RRDPYY--IDPASGYIFRSMKDAVRYVETGEIGRLAYKPKDDGNQD  101 (549)
Q Consensus        38 ~~LP~GWvkE~~~Rk~G~~i-r~DkYY--~DPvsGykFRSkkdV~RYLeTG~Isr~a~kPk~r~~~d  101 (549)
                      .++++.|+.+..+|+.+..| -.|.||  .++..+..||.++..+-|++-+..-.  +..++....|
T Consensus       106 ~~~~P~~~t~~~~r~~~t~i~~~~~~~~~r~~~~~~~~~~q~~ql~~~~~~~~l~--~~s~~~e~~d  170 (272)
T KOG4161|consen  106 NLAIPIRATSCIFRRPGTKIRSHDKYEVKREPKAEDPFREQKKQLFWLERLQDLE--ADSSRGESID  170 (272)
T ss_pred             ccCCchhhhhccccccceeeccccchhhhhccccccccccccceEEEeccccccc--cccccccccC
Confidence            56999999999999999988 667888  88988899999999998887666433  3444444444


No 9  
>PF01429 MBD:  Methyl-CpG binding domain;  InterPro: IPR001739 Methylation at CpG dinucleotide, the most common DNA modification in eukaryotes, has been correlated with gene silencing associated with various phenomena such as genomic imprinting, transposon and chromosome X inactivation, differentiation, and cancer. Effects of DNA methylation are mediated through proteins which bind to symmetrically methylated CpGs. Such proteins contain a specific domain of ~70 residues, the methyl-CpG-binding domain (MBD), which is linked to additional domains associated with chromatin, such as the bromodomain, the AT hook motif,the SET domain, or the PHD finger. MBD-containing proteins appear to act as structural proteins, which recruit a variety of histone deacetylase (HDAC) complexes and chromatin remodelling factors, leading to chromatin compaction and, consequently, to transcriptional repression. The MBD of MeCP2, MBD1, MBD2, MBD4 and BAZ2 mediates binding to DNA, in case of MeCP2, MBD1 and MBD2 preferentially to methylated CpG. In case of human MBD3 and SETDB1 the MBD has been shown to mediate protein-protein interactions [, ]. The MBD folds into an alpha/beta sandwich structure comprising a layer of twisted beta sheet, backed by another layer formed by the alpha1 helix and a hairpin loop at the C terminus. These layers are both amphipathic, with the alpha1 helix and the beta sheet lying parallel and the hydrophobic faces tightly packed against each other. The beta sheet is composed of two long inner strands (beta2 and beta3) sandwiched by two shorter outer strands (beta1 and beta4) [].; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 2KY8_A 1UB1_A 1D9N_A 1IG4_A 1QK9_A 3C2I_A.
Probab=93.24  E-value=0.059  Score=44.75  Aligned_cols=23  Identities=48%  Similarity=0.663  Sum_probs=18.7

Q ss_pred             CCCCCCCCCCeeEEEEEccCCcc
Q 008894            5 ENSDELLPDGCRVEVRVRKNGKK   27 (549)
Q Consensus         5 e~s~~WLPdGW~vEvr~~knG~K   27 (549)
                      ...+.|||+||.+|++++++|+.
T Consensus         5 ~~~~~~Lp~GW~re~~~R~~g~~   27 (77)
T PF01429_consen    5 SPLDPPLPDGWKREVVVRKSGSS   27 (77)
T ss_dssp             ECEBTTSTTT-EEEEEESSSSTT
T ss_pred             ccccCCCCCCCEEEEEEecCCCc
Confidence            45678999999999999998743


No 10 
>cd01396 MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are members of a protein family that share the methyl-CpG-binding domain (MBD). The MBD, consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1.
Probab=89.76  E-value=0.26  Score=41.59  Aligned_cols=16  Identities=44%  Similarity=0.667  Sum_probs=14.9

Q ss_pred             CCCCCeeEEEEEccCC
Q 008894           10 LLPDGCRVEVRVRKNG   25 (549)
Q Consensus        10 WLPdGW~vEvr~~knG   25 (549)
                      +||.||..|++++++|
T Consensus         6 ~lp~GW~r~~~~R~~g   21 (77)
T cd01396           6 RLPPGWKRELVPRKSG   21 (77)
T ss_pred             CCCCCCEEEEEEecCC
Confidence            3999999999999997


No 11 
>KOG1891 consensus Proline binding protein WW45 [General function prediction only]
Probab=89.64  E-value=0.3  Score=49.70  Aligned_cols=41  Identities=37%  Similarity=0.661  Sum_probs=28.4

Q ss_pred             CCCCCCCCCeeEEEEEccCCcceeeE--------eeccCCCCCCCCceEEE
Q 008894            6 NSDELLPDGCRVEVRVRKNGKKDKII--------IEKDTPDGLPPGWTKEI   48 (549)
Q Consensus         6 ~s~~WLPdGW~vEvr~~knG~K~K~v--------iEr~~~~~LP~GWvkE~   48 (549)
                      ..|-=||+||-||--.  -|+||-|-        +-.+..++||+||.+=.
T Consensus        89 sedlPLPpgWav~~T~--~grkYYIDHn~~tTHW~HPlerEgLppGW~rv~  137 (271)
T KOG1891|consen   89 SEDLPLPPGWAVEFTT--EGRKYYIDHNNRTTHWVHPLEREGLPPGWKRVF  137 (271)
T ss_pred             cccCCCCCCcceeeEe--cCceeEeecCCCcccccChhhhccCCcchhhcc
Confidence            3455599999999765  47776651        22235689999997644


No 12 
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=86.66  E-value=0.69  Score=37.02  Aligned_cols=19  Identities=37%  Similarity=0.651  Sum_probs=17.2

Q ss_pred             CCCCCCCCeeEEEEEccCC
Q 008894            7 SDELLPDGCRVEVRVRKNG   25 (549)
Q Consensus         7 s~~WLPdGW~vEvr~~knG   25 (549)
                      ..+|||.||..|++.+++|
T Consensus         2 l~~P~p~GW~R~~~~r~~g   20 (62)
T cd00122           2 LRDPLPPGWKRELVIRKSG   20 (62)
T ss_pred             CCCCCCCCeEEEEEEcCCC
Confidence            4578999999999999997


No 13 
>PF00397 WW:  WW domain;  InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet. This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A ....
Probab=76.70  E-value=1.2  Score=31.41  Aligned_cols=25  Identities=36%  Similarity=0.884  Sum_probs=16.4

Q ss_pred             CCCCceEEEEEecCCCcccccccccCCCCCc
Q 008894           40 LPPGWTKEIKVTKTGRKVRRDPYYIDPASGY   70 (549)
Q Consensus        40 LP~GWvkE~~~Rk~G~~ir~DkYY~DPvsGy   70 (549)
                      ||+||..-.  ...    ....||++..||.
T Consensus         1 LP~gW~~~~--~~~----~g~~YY~N~~t~~   25 (31)
T PF00397_consen    1 LPPGWEEYF--DPD----SGRPYYYNHETGE   25 (31)
T ss_dssp             SSTTEEEEE--ETT----TSEEEEEETTTTE
T ss_pred             CCcCCEEEE--cCC----CCCEEEEeCCCCC
Confidence            899997333  222    1357999998775


No 14 
>smart00456 WW Domain with 2 conserved Trp (W) residues. Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides.
Probab=67.75  E-value=4.6  Score=27.69  Aligned_cols=24  Identities=33%  Similarity=0.816  Sum_probs=17.1

Q ss_pred             CCCCceEEEEEecCCCcccccccccCCCCCc
Q 008894           40 LPPGWTKEIKVTKTGRKVRRDPYYIDPASGY   70 (549)
Q Consensus        40 LP~GWvkE~~~Rk~G~~ir~DkYY~DPvsGy   70 (549)
                      ||.||.+..  -.+     ...||++..|+.
T Consensus         1 lp~gW~~~~--~~~-----g~~yy~n~~t~~   24 (32)
T smart00456        1 LPPGWEERK--DPD-----GRPYYYNHETKE   24 (32)
T ss_pred             CCCCCEEEE--CCC-----CCEEEEECCCCC
Confidence            799998887  222     357898887664


No 15 
>KOG1891 consensus Proline binding protein WW45 [General function prediction only]
Probab=62.14  E-value=3.9  Score=41.91  Aligned_cols=23  Identities=43%  Similarity=0.931  Sum_probs=18.3

Q ss_pred             CCCCCceEEEEEecCCCcccccccccCCCC
Q 008894           39 GLPPGWTKEIKVTKTGRKVRRDPYYIDPAS   68 (549)
Q Consensus        39 ~LP~GWvkE~~~Rk~G~~ir~DkYY~DPvs   68 (549)
                      -||+||.+|.       .++.-|||||=.+
T Consensus        93 PLPpgWav~~-------T~~grkYYIDHn~  115 (271)
T KOG1891|consen   93 PLPPGWAVEF-------TTEGRKYYIDHNN  115 (271)
T ss_pred             CCCCCcceee-------EecCceeEeecCC
Confidence            4999999999       5556789999543


No 16 
>PRK10984 DNA-binding transcriptional regulator Crl; Provisional
Probab=60.61  E-value=5.6  Score=37.34  Aligned_cols=41  Identities=15%  Similarity=0.182  Sum_probs=33.7

Q ss_pred             CCCCCCCCCCCCCeeEEEEEccCCcceeeEeeccCCCCCCCCceEEE
Q 008894            2 GDRENSDELLPDGCRVEVRVRKNGKKDKIIIEKDTPDGLPPGWTKEI   48 (549)
Q Consensus         2 ~~~e~s~~WLPdGW~vEvr~~knG~K~K~viEr~~~~~LP~GWvkE~   48 (549)
                      ..||++..|   |||||.....+|=.|.|.+=+|+..|   .|+.+.
T Consensus        46 ~aPEkREFW---GWWmeL~~~e~~F~y~Y~~Glydk~G---~W~~~~   86 (127)
T PRK10984         46 PAPEKREFW---GWWMELEAQEGRFTYSYQFGLFDKEG---NWVAEP   86 (127)
T ss_pred             CChhhhhhh---hhheeeeecCCcEEEEEecccccCCC---Ceeecc
Confidence            368999999   99999999999999999888876554   455444


No 17 
>PF07417 Crl:  Transcriptional regulator Crl;  InterPro: IPR009986 This family contains the bacterial transcriptional regulator Crl (approximately 130 residues long). This is a transcriptional regulator of the csgA curlin subunit gene for curli fibres that are found on the surface of certain bacteria [].These proteins bind to the sigma-S subunit of RNA polymerase, activating expression of sigma-S-regulated genes. They also stimulate RNA polymerase holoenzyme formation and may bind to several other sigma factors, such as sigma-70 and sigma-32.; GO: 0016987 sigma factor activity, 0045893 positive regulation of transcription, DNA-dependent, 0005737 cytoplasm; PDB: 3RPJ_A.
Probab=58.18  E-value=7.1  Score=36.60  Aligned_cols=43  Identities=16%  Similarity=0.268  Sum_probs=29.3

Q ss_pred             CCCCCCCCCCCCCeeEEEEEccCCcceeeEeeccCCCCCCCCceEEEEE
Q 008894            2 GDRENSDELLPDGCRVEVRVRKNGKKDKIIIEKDTPDGLPPGWTKEIKV   50 (549)
Q Consensus         2 ~~~e~s~~WLPdGW~vEvr~~knG~K~K~viEr~~~~~LP~GWvkE~~~   50 (549)
                      ..||++..|   |||||.....+|=.|+|.+=+|+..|   .|+.+..+
T Consensus        44 ~aPEkREFW---GWWleL~~~e~~F~y~Y~~Glydk~G---~W~~~~i~   86 (125)
T PF07417_consen   44 KAPEKREFW---GWWLELEAQEDGFEYRYQFGLYDKEG---NWQAEKIK   86 (125)
T ss_dssp             S-CCC--EE---EEEEEEEEETTEEEEEEEEEEE-TTS----EES----
T ss_pred             CChhhhhhh---hhheeeEecCCcEEEEEeeccccCCC---CeeecCCC
Confidence            368999999   99999999999999999888876654   46655533


No 18 
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=49.26  E-value=17  Score=30.83  Aligned_cols=18  Identities=44%  Similarity=0.637  Sum_probs=15.8

Q ss_pred             CCCCCCCCCeeEEEEEccCC
Q 008894            6 NSDELLPDGCRVEVRVRKNG   25 (549)
Q Consensus         6 ~s~~WLPdGW~vEvr~~knG   25 (549)
                      +-|  ||.||.-|+.+++.|
T Consensus         5 ~~P--lp~GW~R~~~~r~~g   22 (77)
T smart00391        5 RLP--LPCGWRRETKQRKSG   22 (77)
T ss_pred             cCC--CCCCcEEEEEEecCC
Confidence            445  999999999999987


No 19 
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=44.04  E-value=12  Score=36.26  Aligned_cols=29  Identities=31%  Similarity=0.802  Sum_probs=19.3

Q ss_pred             CCCCCCCceEEEEEecCCCcccccccccCCCCCcc
Q 008894           37 PDGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYI   71 (549)
Q Consensus        37 ~~~LP~GWvkE~~~Rk~G~~ir~DkYY~DPvsGyk   71 (549)
                      .+.||+||.|-+    +-.  +.-.||+.+.|+..
T Consensus         4 ~~~LP~~Wekr~----Srs--~gr~YyfN~~T~~S   32 (163)
T KOG3259|consen    4 EEKLPPGWEKRM----SRS--SGRPYYFNTETNES   32 (163)
T ss_pred             cccCCchhheec----ccc--CCCcceeccccchh
Confidence            468999998855    222  23478988776544


No 20 
>PHA03165 hypothetical protein; Provisional
Probab=36.18  E-value=11  Score=30.78  Aligned_cols=12  Identities=67%  Similarity=1.508  Sum_probs=11.2

Q ss_pred             cccCcccCChhH
Q 008894          360 LPFGDLLSDPCI  371 (549)
Q Consensus       360 ~~~~~~wsDPci  371 (549)
                      +|||+++|.|||
T Consensus        44 spfgeilsspci   55 (57)
T PHA03165         44 SPFGEILSSPCI   55 (57)
T ss_pred             CchhhhhcCccc
Confidence            699999999998


No 21 
>PF00408 PGM_PMM_IV:  Phosphoglucomutase/phosphomannomutase, C-terminal domain;  InterPro: IPR005843 The alpha-D-phosphohexomutase superfamily is composed of four related enzymes, each of which catalyses a phosphoryl transfer on their sugar substrates: phosphoglucomutase (PGM), phosphoglucomutase/phosphomannomutase (PGM/PMM), phosphoglucosamine mutase (PNGM), and phosphoacetylglucosamine mutase (PAGM) []. PGM (5.4.2.2 from EC) converts D-glucose 1-phosphate into D-glucose 6-phosphate, and participates in both the breakdown and synthesis of glucose []. PGM/PMM (5.4.2.2 from EC; 5.4.2.8 from EC) are primarily bacterial enzymes that use either glucose or mannose as substrate, participating in the biosynthesis of a variety of carbohydrates such as lipopolysaccharides and alginate [, ]. Both PNGM (5.4.2.3 from EC) and PAGM (5.4.2.10 from EC) are involved in the biosynthesis of UDP-N-acetylglucosamine [, ].  Despite differences in substrate specificity, these enzymes share a similar catalytic mechanism, converting 1-phospho-sugars to 6-phospho-sugars via a biphosphorylated 1,6-phospho-sugar. The active enzyme is phosphorylated at a conserved serine residue and binds one magnesium ion; residues around the active site serine are well conserved among family members. The reaction mechanism involves phosphoryl transfer from the phosphoserine to the substrate to create a biophosphorylated sugar, followed by a phosphoryl transfer from the substrate back to the enzyme []. The structures of PGM and PGM/PMM have been determined, and were found to be very similar in topology. These enzymes are both composed of four domains and a large central active site cleft, where each domain contains residues essential for catalysis and/or substrate recognition. Domain I contains the catalytic phosphoserine, domain II contains a metal-binding loop to coordinate the magnesium ion, domain III contains the sugar-binding loop that recognises the two different binding orientations of the 1- and 6-phospho-sugars, and domain IV contains a phosphate-binding site required for orienting the incoming phospho-sugar substrate. This entry represents the C-terminal domain alpha-D-phosphohexomutase enzymes.; GO: 0016868 intramolecular transferase activity, phosphotransferases, 0005975 carbohydrate metabolic process; PDB: 1KFQ_B 1KFI_A 3PDK_B 2F7L_A 1TUO_A 2FKM_X 3C04_A 1K2Y_X 1P5G_X 2H4L_X ....
Probab=35.59  E-value=35  Score=27.55  Aligned_cols=26  Identities=31%  Similarity=0.433  Sum_probs=20.9

Q ss_pred             CCCCCeeEEEEEccCCcceeeEeecc
Q 008894           10 LLPDGCRVEVRVRKNGKKDKIIIEKD   35 (549)
Q Consensus        10 WLPdGW~vEvr~~knG~K~K~viEr~   35 (549)
                      .+.|||++.+|...+.-+-|+.+|..
T Consensus        31 ~~~dG~~l~vR~SgTEP~iRv~~Ea~   56 (73)
T PF00408_consen   31 LFEDGWRLLVRPSGTEPKIRVYVEAP   56 (73)
T ss_dssp             EETTEEEEEEEEESSSSEEEEEEEES
T ss_pred             ECCCceEEEEECCCCCceEEEEEEeC
Confidence            35689999988888888888888864


No 22 
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs.
Probab=30.15  E-value=44  Score=22.37  Aligned_cols=23  Identities=26%  Similarity=0.658  Sum_probs=15.0

Q ss_pred             CCCceEEEEEecCCCcccccccccCCCCCc
Q 008894           41 PPGWTKEIKVTKTGRKVRRDPYYIDPASGY   70 (549)
Q Consensus        41 P~GWvkE~~~Rk~G~~ir~DkYY~DPvsGy   70 (549)
                      |.||.+-.  -+.     ...||++..++.
T Consensus         1 p~~W~~~~--~~~-----g~~yy~n~~t~~   23 (31)
T cd00201           1 PPGWEERW--DPD-----GRVYYYNHNTKE   23 (31)
T ss_pred             CCCCEEEE--CCC-----CCEEEEECCCCC
Confidence            78888666  111     357888887654


No 23 
>PF14657 Integrase_AP2:  AP2-like DNA-binding integrase domain
Probab=22.12  E-value=62  Score=24.44  Aligned_cols=21  Identities=24%  Similarity=0.373  Sum_probs=16.1

Q ss_pred             cCCCCCc-------cccchHHHHHHHhh
Q 008894           64 IDPASGY-------IFRSMKDAVRYVET   84 (549)
Q Consensus        64 ~DPvsGy-------kFRSkkdV~RYLeT   84 (549)
                      ++|.+|.       -|.+++++..++..
T Consensus         9 ~~~~~Gkrk~~~k~GF~TkkeA~~~~~~   36 (46)
T PF14657_consen    9 YDDETGKRKQKTKRGFKTKKEAEKALAK   36 (46)
T ss_pred             EECCCCCEEEEEcCCCCcHHHHHHHHHH
Confidence            6676774       39999999998853


No 24 
>PF08265 YL1_C:  YL1 nuclear protein C-terminal domain;  InterPro: IPR013272 This domain is found at the C terminus in proteins of the YL1 family []. These proteins have been shown to be DNA-binding and may be transcription factors []. This domain is also found in proteins that do not belong to the YL1 family.
Probab=21.84  E-value=52  Score=24.04  Aligned_cols=17  Identities=24%  Similarity=0.514  Sum_probs=14.1

Q ss_pred             ccccCCCCCccccchHH
Q 008894           61 PYYIDPASGYIFRSMKD   77 (549)
Q Consensus        61 kYY~DPvsGykFRSkkd   77 (549)
                      --|+||.||..|.+...
T Consensus        10 A~Y~DP~T~l~Y~n~~a   26 (30)
T PF08265_consen   10 ARYRDPKTGLPYANSEA   26 (30)
T ss_pred             ccccCCCCCCcccCHHH
Confidence            45999999999988754


Done!