BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008932
         (548 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MKT|A Chain A, Structure Of A Cation-Bound Multidrug And Toxin Compound
           Extrusion (Mate) Transporter
 pdb|3MKT|B Chain B, Structure Of A Cation-Bound Multidrug And Toxin Compound
           Extrusion (Mate) Transporter
 pdb|3MKU|A Chain A, Structure Of A Cation-Bound Multidrug And Toxin Compound
           Extrusion (Mate) Transporter
 pdb|3MKU|B Chain B, Structure Of A Cation-Bound Multidrug And Toxin Compound
           Extrusion (Mate) Transporter
          Length = 460

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 316 SFSVPSTNELATILGLAGPVFITMISKVAFYSLIIYFATSMGTNTVAAHQV 366
           +F  P   EL  +  L  PV   +  +V  ++++      +G+  VAAHQV
Sbjct: 228 TFHKPQPKELIRLFRLGFPVAAALFFEVTLFAVVALLVAPLGSTVVAAHQV 278


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.136    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,626,112
Number of Sequences: 62578
Number of extensions: 473300
Number of successful extensions: 1170
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1168
Number of HSP's gapped (non-prelim): 3
length of query: 548
length of database: 14,973,337
effective HSP length: 104
effective length of query: 444
effective length of database: 8,465,225
effective search space: 3758559900
effective search space used: 3758559900
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)