Citrus Sinensis ID: 008945


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
MWVLGVTERRVMGAFWVLNLVLFLVQVVGIKGAHGIGEHGVRIWPMPLSVSHGHKSLYVGKDFKIMSQGSKYKDASGILKDGFSRFLAVVKGAHVVDGDTSKLDQSRVLQGLNVFISSTKDELQYGIDESYKLLVPSPDKPTYAHLEAQTVYGALHGLQTLSQLCQFNFSSRVIEILMTPWIINDQPRFSFRGLLIDTSRHYQPLPIIKNVIDSMAYAKLNVLHWHIVDTQSFPLEIPSYPKLWDGAYSTSERYTMADAAEIVSYAQKRGINVLAELDVPGHALSWGKGYPSLWPSKDCQEPLDVSNEFTFKVIDGILSDFSKVFKYKFVHLGGDEVNTSCWTLTPHVSKWLKEHSMNESQAYQYFVLQAQKIALLHGYEIVNWEETFNNFGNKLSPKTVVHNWLGGGVAQRVVAAGLRCIVSNQDKWYLDHLDTTWEQFYMNEPLTNITKSEQQKLVIGGEVCMWGETVDASDIQQTIWPRAAAAAERLWTPYDKLAKEAKQVTGRLAHFRCLLNQRGIAAAPLAADTPLTQPGRSAPLEPGSCYLQ
cccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEccccccccccccccEEEEEcccccccEEEEEEccHHHHHHHHHHHHHHHcccccccEEEEEEcccEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccEEEEEccccHHHHHHHccccEEEEcccccEEccccccHHHHcccccccccccHHHHccEEEEEEccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
MWVLGVTERRVMGAFWVLNLVLFLVQVVGIKGAHGIGEHGVRIWPMPLSVSHGHKSLYVGKDFKIMSQGSKYKDASGILKDGFSRFLAVVKGAHVVDGDTSKLDQSRVLQGLNVFISSTKDELQYGIDESYKLLVPSPDKPTYAHLEAQTVYGALHGLQTLSQLCQFNFSSRVIEILMTPWIINDQPRFSFRGLLIDTSRHYQPLPIIKNVIDSMAYAKLNVLHWHIVDTQSFPLEIPSYPKLWDGAYSTSERYTMADAAEIVSYAQKRGINVLAELDVPGHALSWGKGYPSLWPSKDCQEPLDVSNEFTFKVIDGILSDFSKVFKYKFVHLGGDEVNTSCWTLTPHVSKWLKEHSMNESQAYQYFVLQAQKIALLHGYEIVNWEETFNNFGNKLSPKTVVHNWLGGGVAQRVVAAGLRCIVSNQDKWYLDHLDTTWEQFYMNEPLTNITKSEQQKLVIGGEVCMWGETVDASDIQQTIWPRAAAAAERLWTPYDKLAKEAKQVTGRLAHFRCLLNQRGIAAAPLAADTPLTQPGRSAPLEPGSCYL*
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWVLGVTERRVMGAFWVLNLVLFLVQVVGIKGAHGIGEHGVRIWPMPLSVSHGHKSLYVGKDFKIMSQGSKYKDASGILKDGFSRFLAVVKGAHVVDGDTSKLDQSRVLQGLNVFISSTKDELQYGIDESYKLLVPSPDKPTYAHLEAQTVYGALHGLQTLSQLCQFNFSSRVIEILMTPWIINDQPRFSFRGLLIDTSRHYQPLPIIKNVIDSMAYAKLNVLHWHIVDTQSFPLEIPSYPKLWDGAYSTSERYTMADAAEIVSYAQKRGINVLAELDVPGHALSWGKGYPSLWPSKDCQEPLDVSNEFTFKVIDGILSDFSKVFKYKFVHLGGDEVNTSCWTLTPHVSKWLKEHSMNESQAYQYFVLQAQKIALLHGYEIVNWEETFNNFGNKLSPKTVVHNWLGGGVAQRVVAAGLRCIVSNQDKWYLDHLDTTWEQFYMNEPLTNITKSEQQKLVIGGEVCMWGETVDASDIQQTIWPRAAAAAERLWTPYDKLAKEAKQVTGRLAHFRCLLNQRGIAAAPLAADTPLTQPGRSAPLEPGSCYLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-hexosaminidase 3 Has a broad substrate specificity. Can use synthetic substrates such as pyridylaminated chitotriose, p-nitrophenyl-beta-N-acetylglucosaminide, p-nitrophenyl-2-acetamido-2-deoxy-beta-D-glucopyranoside (pNP-GlcNAc), p-nitrophenyl-2-acetamido-2-deoxy-beta-D-galactopyranoside (pNP-GalNAc), 4-methylumbelliferyl-2-acetamido-2-deoxy-beta-D-glucopyranoside (MU-GlcNAc), and 4-methylumbelliferyl-6-sulfo-2-acetamido-2-deoxy-beta-D-glucopyranoside (MU-GlcNAc-6SO(4)) as substrates. Removes terminal GlcNAc residues from alpha1,3- and alpha1,6-mannosyl branches of biantennary N-glycans without any strict branch preference. Required for the presence of paucimannosidic N-glycans in glycoproteins of roots and leaves.confidentQ8L7S6
Beta-hexosaminidase subunit B2 Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines.probableQ54K56
Beta-hexosaminidase A Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines. Degrades chitotriose.probableQ22492

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.52Transferred entry: 3.2.1.52.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RCN, chain A
Confidence level:very confident
Coverage over the Query: 39-531
View the alignment between query and template
View the model in PyMOL
Template: 3OZO, chain A
Confidence level:very confident
Coverage over the Query: 42-546
View the alignment between query and template
View the model in PyMOL