BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 008986
         (547 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2M0O|A Chain A, The Solution Structure Of Human Phf1 In Complex With
           H3k36me3
          Length = 79

 Score = 31.2 bits (69), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 436 NGAMALWQPGVPSPYSVPNGAPSGYEAMDMTPKW 469
           +GA +LW P  P+P S P   P  +E  D+  +W
Sbjct: 6   SGASSLWDPASPAPTSGPR--PRLWEGQDVLARW 37


>pdb|2QUD|A Chain A, Pp7 Coat Protein Dimer
 pdb|2QUD|B Chain B, Pp7 Coat Protein Dimer
 pdb|2QUX|A Chain A, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|B Chain B, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|D Chain D, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|E Chain E, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|G Chain G, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|H Chain H, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|J Chain J, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|K Chain K, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|M Chain M, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|N Chain N, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|P Chain P, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
 pdb|2QUX|Q Chain Q, Pp7 Coat Protein Dimer In Complex With Rna Hairpin
          Length = 125

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 167 SDITDSGSQEM---QPITENVEICSNHEECDARRSQIKLTKGFAAKEQVKGHMVNVV 220
           +D+ DSG  ++   Q  + +V I +N  E  +R+S   LTK   A  QV+  +VN+V
Sbjct: 66  ADVVDSGLPKVRYTQVWSHDVTIVANSTEA-SRKSLYDLTKSLVATSQVEDLVVNLV 121


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,324,166
Number of Sequences: 62578
Number of extensions: 570407
Number of successful extensions: 1195
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1195
Number of HSP's gapped (non-prelim): 2
length of query: 547
length of database: 14,973,337
effective HSP length: 104
effective length of query: 443
effective length of database: 8,465,225
effective search space: 3750094675
effective search space used: 3750094675
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)