Citrus Sinensis ID: 009008

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------
MAAHPAYAETMSFGGSNHGQGQEAVPFETHQGSLKVLLLHGNLDIWVKEAKNLPNMDMFHKKIGDVFGKLNVKVTSKIESHLSDKITSDPYVTVSICGAVIGRTFVISNSESPVWMQHFNVPVAHSAAEVHFVVKDNDFVGSQIMGAVGIPVEKLCSGDKIEGAFPILNSSRKPCKAGAVLSLSIQYTPVENMSLYYRGVGSGPDYIGVPGTYFPLRRGGKVTLYQDAHAHDGCLADLKLDGGVQFNHESCWQDVYDAINQARRLIYITGWSVYHTVRLVRDGSNTLMLGDLLKIKSQEGVRVLILAWDDPTSRSILGYKTDGIMSTNDEETRRFFKHSSVQVLLCPRSAGKGHSFVKKQEVGTIYTHHQKTVVVDADAGQFKRKIIAFVGGLDLCKGRYDTPAHPLFKTLETVHKDDYYNPSLLEPIAGGPREPWHDLHCRIDGPAAYDILTNFEERWLKASKPHGLQKLKSSNDDSLLKLERIPEIVGMTEASYLSENDPEAWHAQVFRSIDSNSVKGFPVEPRDATSMVRISNIIWWLRANDD
cccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEECccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEEccccccccccEEEEEEccccccEEEEEEECcccccccEEEEEEEccccccccccCEEEEEcccccccccccccEEEEEEEEECccccccEECcccccccccccccccccccccccEEEcccccccccccccccccccCECccHHHHHHHHHHHHHcccEEEEEEEEccccccEEEcccccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccHHHHHHHccccccEEEcccccccccEEEEEcccccccccccEEEEEccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccCEEEEEECcHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccCEEEEEccccccccccccccccccccEEEEcEEEEEEccccc
****************************THQGSLKVLLLHGNLDIWVKEAKNLPNMDMFHKKIGDVFGKLNVKVTSKI****SDKITSDPYVTVSICGAVIGRTFVISNSESPVWMQHFNVPVAHSAAEVHFVVKDNDFVGSQIMGAVGIPVEKLCSGDKIEGAFPILNSSRKPCKAGAVLSLSIQYTPVENMSLYYRGVGSGPDYIGVPGTYFPLRRGGKVTLYQDAHAHDGCLADLKLDGGVQFNHESCWQDVYDAINQARRLIYITGWSVYHTVRLVRDGSNTLMLGDLLKIKSQEGVRVLILAWDDPTSRSILGYKTDGIMSTNDEETRRFFKHSSVQVLLCPRSAGKGHSFVKKQEVGTIYTHHQKTVVVDADAGQFKRKIIAFVGGLDLCKGRYDTPAHPLFKTLETVHKDDYYNPSLLEPIAGGPREPWHDLHCRIDGPAAYDILTNFEERWLKASKPHGLQKLKSSNDDSLLKLERIPEIVGMTEASYLSENDPEAWHAQVFRSIDSNSVKGFPVEPRDATSMVRISNIIWWLRAND*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAHPAYAETMSFGGSNHGQGQEAVPFETHQGSLKVLLLHGNLDIWVKEAKNLPNMDMFHKKIGDVFGKLNVKVTSKIESHLSDKITSDPYVTVSICGAVIGRTFVISNSESPVWMQHFNVPVAHSAAEVHFVVKDNDFVGSQIMGAVGIPVEKLCSGDKIEGAFPILNSSRKPCKAGAVLSLSIQYTPVENMSLYYRGVGSGPDYIGVPGTYFPLRRGGKVTLYQDAHAHDGCLADLKLDGGVQFNHESCWQDVYDAINQARRLIYITGWSVYHTVRLVRDGSNTLMLGDLLKIKSQEGVRVLILAWDDPTSRSILGYKTDGIMSTNDEETRRFFKHSSVQVLLCPRSAGKGHSFVKKQEVGTIYTHHQKTVVVDADAGQFKRKIIAFVGGLDLCKGRYDTPAHPLFKTLETVHKDDYYNPSLLEPIAGGPREPWHDLHCRIDGPAAYDILTNFEERWLKASKPHGLQKLKSSNDDSLLKLERIPEIVGMTEASYLSENDPEAWHAQVFRSIDSNSVKGFPVEPRDATSMVRISNIIWWLRANDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phospholipase D gamma 1 Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond. Plays an important role in various cellular processes, including phytohormone action, vesicular trafficking, secretion, cytoskeletal arrangement, meiosis, tumor promotion, pathogenesis, membrane deterioration and senescence. Can use phosphatidylserine but prefers ethanolamine-containing lipids as substrates.probableQ9T053

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.4.-Phosphoric diester hydrolases.probable
3.1.4.4Phospholipase D.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R83, chain A
Confidence level:very confident
Coverage over the Query: 39-58,85-192
View the alignment between query and template
View the model in PyMOL
Template: 1V0W, chain A
Confidence level:confident
Coverage over the Query: 250-400,436-463
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3hsi, chain A confident Alignment | Template Structure