Citrus Sinensis ID: 009052

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-----
MADYEVNGEDVDNNNNNNNNNYEYGSSPQPRSADDHSDSKPQHGSRDYERESSRSREKEKEKGRDRDRDRDRDRTREKDRDREKSRDMDREKSRDREKDREKDRHHRDRHRERSRERSERRKDRDDDDHYRSRDYDRRKDYDRDREDRHKRRSQSRSRGRSEHRSRSRSRSRSKSKRISGFDMAPPASAMLAAGAGAAAAGQIPGANPAIPGMFPNMFPLVTGQQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHccccccccccEEEECcccccccHHHHHHHHHHHHHHHccccccccccEEEEEEcccccEEEEEEEcHHHHHHHHHccccEEccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccEEEEEcccccccccccEEEEEEccHHHHHHHHHHHcccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHccccEEEEECcccccEECccccccccEEEEEEEc
**********************************************************************************************************************************************************************************SGFDMA**********************NPAIPGMFPNMFPLV*********************RHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVK****************************VGLT***AGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRAN**************LHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADYEVNGEDVDNNNNNNNNNYEYGSSPQPRSADDHSDSKPQHGSRDYERESSRSREKEKEKGRDRDRDRDRDRTREKDRDREKSRDMDREKSRDREKDREKDRHHRDRHRERSRERSERRKDRDDDDHYRSRDYDRRKDYDRDREDRHKRRSQSRSRGRSEHRSRSRSRSRSKSKRISGFDMAPPASAMLAAGAGAAAAGQIPGANPAIPGMFPNMFPLVTGQQFGALPVMPVQAMTQQATRHARRVYVGGLPPTANEQSVATFFSQVMAAIGGNTAGPGDAVVNVYINHEKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGIKMGDKTLTVRRANQGANQPKPEQESVLLHAQQQIALQRLMLQPGSVPSKVVCLTQVVSADELKDDEEYEEILEDMRQEGGKFAFCSPTFCYKESGLIYTDRRLHNPQFVYFYIHL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor U2af large subunit B Necessary for the splicing of pre-mRNA. Binds to the U -enriched regions of plant introns.probableQ9ZR40
Splicing factor U2af large subunit B Necessary for the splicing of pre-mRNA.probableQ2QZL4
Splicing factor U2af large subunit B Necessary for the splicing of pre-mRNA.probableQ2QKB4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PGW, chain S
Confidence level:very confident
Coverage over the Query: 364-446
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain S
Confidence level:very confident
Coverage over the Query: 244-331
View the alignment between query and template
View the model in PyMOL
Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 240-272,285-329,365-448,473-528
View the alignment between query and template
View the model in PyMOL
Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 245-446
View the alignment between query and template
View the model in PyMOL
Template: 3TYT, chain A
Confidence level:very confident
Coverage over the Query: 365-542
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 51-127
View the alignment between query and template
View the model in PyMOL
Template: 3SQW, chain A
Confidence level:probable
Coverage over the Query: 73-102
View the alignment between query and template
View the model in PyMOL