BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 009058
         (545 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On
           Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes
           Obtained By Electron Tomography
 pdb|1Q55|B Chain B, W-Shaped Trans Interactions Of Cadherins Model Based On
           Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes
           Obtained By Electron Tomography
 pdb|1Q55|C Chain C, W-Shaped Trans Interactions Of Cadherins Model Based On
           Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes
           Obtained By Electron Tomography
 pdb|1Q55|D Chain D, W-Shaped Trans Interactions Of Cadherins Model Based On
           Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes
           Obtained By Electron Tomography
 pdb|1Q5A|A Chain A, S-Shaped Trans Interactions Of Cadherins Model Based On
           Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes
           Obtained By Electron Tomography
 pdb|1Q5A|B Chain B, S-Shaped Trans Interactions Of Cadherins Model Based On
           Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes
           Obtained By Electron Tomography
 pdb|1Q5B|A Chain A, Lambda-Shaped Trans And Cis Interactions Of Cadherins
           Model Based On Fitting C-Cadherin (1l3w) To 3d Map Of
           Desmosomes Obtained By Electron Tomography
 pdb|1Q5B|B Chain B, Lambda-Shaped Trans And Cis Interactions Of Cadherins
           Model Based On Fitting C-Cadherin (1l3w) To 3d Map Of
           Desmosomes Obtained By Electron Tomography
 pdb|1Q5B|C Chain C, Lambda-Shaped Trans And Cis Interactions Of Cadherins
           Model Based On Fitting C-Cadherin (1l3w) To 3d Map Of
           Desmosomes Obtained By Electron Tomography
 pdb|1Q5C|A Chain A, S-S-Lambda-Shaped Trans And Cis Interactions Of Cadherins
           Model Based On Fitting C-Cadherin (1l3w) To 3d Map Of
           Desmosomes Obtained By Electron Tomography
 pdb|1Q5C|B Chain B, S-S-Lambda-Shaped Trans And Cis Interactions Of Cadherins
           Model Based On Fitting C-Cadherin (1l3w) To 3d Map Of
           Desmosomes Obtained By Electron Tomography
 pdb|1Q5C|C Chain C, S-S-Lambda-Shaped Trans And Cis Interactions Of Cadherins
           Model Based On Fitting C-Cadherin (1l3w) To 3d Map Of
           Desmosomes Obtained By Electron Tomography
 pdb|1Q5C|D Chain D, S-S-Lambda-Shaped Trans And Cis Interactions Of Cadherins
           Model Based On Fitting C-Cadherin (1l3w) To 3d Map Of
           Desmosomes Obtained By Electron Tomography
          Length = 880

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 353 PLRYGGITIYQTDWSFSALQVLKNDEGPFNLAMAPLKVNGDK--KLFGTFLPLGDVNSP 409
           P  + G+   + DW    ++V +N+ GPF   +  +K N D+  K++ +    G  N P
Sbjct: 144 PETHTGLKRKKRDWVIPPIKVSENERGPFPKRLVQIKSNKDRFNKVYYSITGQGADNPP 202


>pdb|1EYX|B Chain B, Crystal Structure Of R-Phycoerythrin At 2.2 Angstroms
 pdb|1EYX|L Chain L, Crystal Structure Of R-Phycoerythrin At 2.2 Angstroms
          Length = 177

 Score = 29.3 bits (64), Expect = 5.9,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 500 DGTSVIIGGKTNRAKAEFPDDMNRLLDRVPELVESSLSKQSDGISG 545
           D  +  +GG   +A   F  D N+ LD V  +V +S    SD ISG
Sbjct: 13  DAKAAYVGGSDLQALRTFISDGNKRLDAVNYIVSNSSCIVSDAISG 58


>pdb|3V57|B Chain B, Crystal Structure Of The B-Phycoerythrin From The Red
           Algae Porphyridium Cruentum At Ph8
 pdb|3V57|D Chain D, Crystal Structure Of The B-Phycoerythrin From The Red
           Algae Porphyridium Cruentum At Ph8
 pdb|3V58|B Chain B, Crystal Structure Of The B-Phycoerythrin From The Red
           Algae Porphyridium Cruentum At Ph5
 pdb|3V58|D Chain D, Crystal Structure Of The B-Phycoerythrin From The Red
           Algae Porphyridium Cruentum At Ph5
          Length = 177

 Score = 28.9 bits (63), Expect = 8.2,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 23/46 (50%)

Query: 500 DGTSVIIGGKTNRAKAEFPDDMNRLLDRVPELVESSLSKQSDGISG 545
           D  +  +GG   +A   F  D N+ LD V  +V ++    SD +SG
Sbjct: 13  DAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASCMVSDAVSG 58


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.139    0.414 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,668,943
Number of Sequences: 62578
Number of extensions: 637254
Number of successful extensions: 1214
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1209
Number of HSP's gapped (non-prelim): 9
length of query: 545
length of database: 14,973,337
effective HSP length: 104
effective length of query: 441
effective length of database: 8,465,225
effective search space: 3733164225
effective search space used: 3733164225
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)