Citrus Sinensis ID: 009104


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---
MATSATGQPQFIASTGGNRSFSNAPLIKNEDADQIVVPDKTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAANLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIGVLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASMILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFIKFLFHGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLALTTHENQHSTNESGNASLYSLPREDIASMQLPSRSGTVDID
ccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHEEECcccHHHHHccccccccccccHHHHHHHHccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccccccccccccccccccccccccccccccccccccc
*******************************ADQIVVPDKTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAANLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIGVLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASMILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFIKFLFHGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLAL**********************EDIASM************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSATGQPQFIASTGGNRSFSNAPLIKNEDADQIVVPDKTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAANLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIGVLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASMILSFELPFALVPLLKFTSSKVKMGMHANSIAITAITWIIGSLIMIINVYYLATSFIKFLFHGNLKLVEVVFLGIFGFSAMAVYLAGVAYLVLRKNKEASHLLALTTHENQHSTNESGNASLYSLPREDIASMQLPSRSGTVDID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metal transporter Nramp1 High affinity manganese (Mn) transporter involved in Mn acquisition from the soil. Required for Mn uptake into the root in conditions of low Mn availability. Can transport iron (Fe), cadmium (Cd) and cobalt (Co).confidentQ9SAH8
Metal transporter Nramp3 Probable metal transporter.confidentQ653V6
Natural resistance-associated macrophage protein 1 Divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. Controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe(2+) and Mn(2+), cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes.probableP41251

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JLN, chain A
Confidence level:confident
Coverage over the Query: 54-188
View the alignment between query and template
View the model in PyMOL
Template: 3GIA, chain A
Confidence level:probable
Coverage over the Query: 314-353
View the alignment between query and template
View the model in PyMOL