Citrus Sinensis ID: 009111

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---

MQASTYAIKASVCFDARNRRRACVLAAGFANTRSVALNCNFTSNNSICMRDMGMKLTRATQGVETLFRSTVKPRSVKAQASAGDIEEATPFKPQAKKSSGVVLPFVGVACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGSLADKFGRTRTFQLDAVPLAAGAFLCATAQSVQTMIIGRVLAGIGIGISSAIVPLYISEISPTEIRGALGSVNQLFICVGILAALVAGLPLAGNPLWWRTMFGLAAIPSILLALGMGLSPESPRWLFQQGKKSEAEKSIQTLYGKERVSEVMLDLTNAGQGSAEPEAGWFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYYSTSVFRSVGIESDVAASALVGAANVFGTAVASSLMDRQGRKNLLTFSFTGMAASMLLLSLSFTWKVLAPYSGTLAVLGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAVNVVETKGRSLEEIERALNPVV

ccccccEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHcccccHHHHHHHHHHHHHHccccccEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccc

*****YAIKASVCFDARNRRRACVLAAGFANTRSVALNCNF**********************************************************GVVLPFVGVACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGSLADKFGRTRTFQLDAVPLAAGAFLCATAQSVQTMIIGRVLAGIGIGISSAIVPLYISEISPTEIRGALGSVNQLFICVGILAALVAGLPLAGNPLWWRTMFGLAAIPSILLALGMGLSPESPRWLFQQGKKSEAEKSIQTLYGKERVSEVMLDL**********EAGWFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYYSTSVFRSVGIESDVAASALVGAANVFGTAVASSLMDRQGRKNLLTFSFTGMAASMLLLSLSFTWKVLAPYSGTLAVLGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSLGMHWISNFVIGLYFLSVVNKFGISTVYLGFATVCLLAVLYIAVNVVETKGRSLEEIERALNPV*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Plastidic glucose transporter 4	May be involved in the efflux of glucose towards the cytosol.	confident	Q56ZZ7
Galactose-proton symporter	Uptake of galactose across the boundary membrane with the concomitant transport of protons into the cell (symport system).	probable	P0AEP2
Putative metabolite transport protein YwtG		probable	C0SPB2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 100-540
View the alignment between query and template
View the model in PyMOL