BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 009176
(541 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3NPK|A Chain A, The Crystal Structure Of Geranyltranstransferase From
Campylobacter Jejuni
pdb|3NPK|B Chain B, The Crystal Structure Of Geranyltranstransferase From
Campylobacter Jejuni
Length = 291
Score = 30.0 bits (66), Expect = 3.1, Method: Compositional matrix adjust.
Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)
Query: 264 LGEKIRCFVEDKRL-INRVKRVHNSTSIEEVSSRLENGVATKEEVDHQLRDDDSDGIYHG 322
+G+ I CF EDKRL +N ++ +H + +++ L+ G E L +++S+ IY
Sbjct: 149 IGQAIDCFFEDKRLSLNELEFLHTHKTARLIAAALKXGCEICE-----LNNEESNQIY-K 202
Query: 323 LGAK 326
LG K
Sbjct: 203 LGLK 206
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.140 0.429
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,682,058
Number of Sequences: 62578
Number of extensions: 509111
Number of successful extensions: 1433
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1432
Number of HSP's gapped (non-prelim): 8
length of query: 541
length of database: 14,973,337
effective HSP length: 104
effective length of query: 437
effective length of database: 8,465,225
effective search space: 3699303325
effective search space used: 3699303325
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)