BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 009176
         (541 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NPK|A Chain A, The Crystal Structure Of Geranyltranstransferase From
           Campylobacter Jejuni
 pdb|3NPK|B Chain B, The Crystal Structure Of Geranyltranstransferase From
           Campylobacter Jejuni
          Length = 291

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 264 LGEKIRCFVEDKRL-INRVKRVHNSTSIEEVSSRLENGVATKEEVDHQLRDDDSDGIYHG 322
           +G+ I CF EDKRL +N ++ +H   +   +++ L+ G    E     L +++S+ IY  
Sbjct: 149 IGQAIDCFFEDKRLSLNELEFLHTHKTARLIAAALKXGCEICE-----LNNEESNQIY-K 202

Query: 323 LGAK 326
           LG K
Sbjct: 203 LGLK 206


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,682,058
Number of Sequences: 62578
Number of extensions: 509111
Number of successful extensions: 1433
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1432
Number of HSP's gapped (non-prelim): 8
length of query: 541
length of database: 14,973,337
effective HSP length: 104
effective length of query: 437
effective length of database: 8,465,225
effective search space: 3699303325
effective search space used: 3699303325
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)