Citrus Sinensis ID: 009196

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540
MASRLRFSGTHRDVVDVAGSTNTLRKSSEVNGLNKDVQKLLWKNKMKFPKADAKLKSLGLLGPAKSKMKVMEDKEQEGVVDSNNSHATNGNGCMKGTGDSVDESECSPCVPEENNIVNDRPLKKAKSENVENCCSVEGDNGVSVLEEDTRNNTADTQPAAKIDDILPETDGSLKTHSREKKLIDFREKLYLAPLTTVGNLPFRRVCKVLGADVTCGEMAMCTNLLQGQASEWALLRRHSSEDLFGVQICGAYPDTLARTVELIDQQCTVDFIDINMGCPIDIVVNKGAGSCLLTKPMRMKGIIEATSGTVDKPITIKVRTGYFEGKNRIDSLIADIGTWGASAVTVHGRTRQQRYSKLADWDYIYQCARKASDDLQVLGNGDIYSYLDWNKHKSDCPELASCMIARGALIKPWIFTEIKEQRHWDITSGERLNIMKDFARFGLEHWGSDKKGVETTRHFLLEWLSYTCRYIPVGLLDVIPQRLNWRPPAYSGRDDLETLMASDSAADWIRISEMLLGKVPDGFTFAPKHKSNAYDRAENG
ccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHccccEEEEcccccHHHHcccHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccccHHHccccccccccccHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHcccccEEccccccccccccccccHHHHHHHHHccccccEEEccccccHHHHHHHHHccccccEEEEccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccHcccc
*ASRLRF*GTHRDVVDVAG***********NGLNKDVQKLLWKNKMKFPKADAKL*******************************************************PEENNI*************************************************************REKKLIDFREKLYLAPLTTVGNLPFRRVCKVLGADVTCGEMAMCTNLLQGQASEWALLRRHSSEDLFGVQICGAYPDTLARTVELIDQQCTVDFIDINMGCPIDIVVNKGAGSCLLTKPMRMKGIIEATSGTVDKPITIKVRTGYFEGKNRIDSLIADIGTWGASAVTVHGRTRQQRYSKLADWDYIYQCARKASDDLQVLGNGDIYSYLDWNKHKSDCPELASCMIARGALIKPWIFTEIKEQRHWDITSGERLNIMKDFARFGLEHWGSDKKGVETTRHFLLEWLSYTCRYIPVGLLDVIPQRLNWRPPAYSGRDDLETLMASDSAADWIRISEMLLGKVPDGFTFAPKHK**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRLRFSGTHRDVVDVAGSTNTLRKSSEVNGLNKDVQKLLWKNKMKFPKADAKLKSLGLLGPAKSKMKVMEDKEQEGVVDSNNSHATNGNGCMKGTGDSVDESECSPCVPEENNIVNDRPLKKAKSENVENCCSVEGDNGVSVLEEDTRNNTADTQPAAKIDDILPETDGSLKTHSREKKLIDFREKLYLAPLTTVGNLPFRRVCKVLGADVTCGEMAMCTNLLQGQASEWALLRRHSSEDLFGVQICGAYPDTLARTVELIDQQCTVDFIDINMGCPIDIVVNKGAGSCLLTKPMRMKGIIEATSGTVDKPITIKVRTGYFEGKNRIDSLIADIGTWGASAVTVHGRTRQQRYSKLADWDYIYQCARKASDDLQVLGNGDIYSYLDWNKHKSDCPELASCMIARGALIKPWIFTEIKEQRHWDITSGERLNIMKDFARFGLEHWGSDKKGVETTRHFLLEWLSYTCRYIPVGLLDVIPQRLNWRPPAYSGRDDLETLMASDSAADWIRISEMLLGKVPDGFTFAPKHKSNAYDRAENG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.probableQ9T0J6
tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.probableQ28BT8
tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.probableQ7XT07

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VHN, chain A
Confidence level:very confident
Coverage over the Query: 187-474,490-517
View the alignment between query and template
View the model in PyMOL
Template: 2C6Q, chain A
Confidence level:confident
Coverage over the Query: 170-278,289-412
View the alignment between query and template
View the model in PyMOL