Citrus Sinensis ID: 009201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540
MIKLMDKWRITNHLLKHSSKLLFDRRLSANSHNSVFRSALECSESLVKRGFGNASTIRYRCFGSEATKFERNAAFSTLNSEDVSYFKELLGEKSVIQDEDVLLAANEDWMRKYRGSSKLLLQPRTTNEILKYCNSRLLAVVPQGGNTGLVGGSVPVFDEVIINMGSMNNIITFDKGSGVLVCEAGCILENLVSFLDDHGFIMPLDLGAKGSCQIGGNVSTNAGGLRLVRYGSLHGNVLGLEAVLANGDVIDMLGTLRKDNTGYDLKHLFIGSEGSLGIVTKVSIHTPPKLSSVNLAFLACKDYFSCQKLLREAKRKLGEILSAFEFLDNQSMDLVLTYLEGVRNPFSSSMHNFYVLIETTGSEESYDREKLEAFLLSSMEGGLISDGVIAQDINQASSFWRIREGIAEALMKAGAVYKYDLSLPVEKMYDLVEKMRQRLGETAKVIGYGHLGDGNLHLNISAPRYDDMIFAQIEPYVYEWTSEHRGSISAEHGLGLMKANKIFYSKSPKTVQLMSSIKKLLDPNGILNPYKVLPHSLSNH
cccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHcccccccccccccEEEccccHHHHHHHHHHccccEEEcccccccccccccccccEEEEcccccccccccccccEEEEccccHHHHHHHHHHHccccccccccccccccccHHHccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHHccccccEEccccHHHHHHHHHHHccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccHHHHHHccccccccEECcccHHHHHHHHHHHHHccccEEEEEccccccccccCEccccccHHHHHHHHHHHHHHHHHcccCEccccccccccHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccc
****MDKWRITNHLLKHSSKLLFDRRLSANSHNSVFRSALECSESLVKRGFGNASTIRYRCFGSEATKFERNAAFSTLNSEDVSYFKELLGEKSVIQDEDVLLAANEDWMRKYRGSSKLLLQPRTTNEILKYCNSRLLAVVPQGGNTGLVGGSVPVFDEVIINMGSMNNIITFDKGSGVLVCEAGCILENLVSFLDDHGFIMPLDLGAKGSCQIGGNVSTNAGGLRLVRYGSLHGNVLGLEAVLANGDVIDMLGTLRKDNTGYDLKHLFIGSEGSLGIVTKVSIHTPPKLSSVNLAFLACKDYFSCQKLLREAKRKLGEILSAFEFLDNQSMDLVLTYLEGVRNPFSSSMHNFYVLIETTGSEESYDREKLEAFLLSSMEGGLISDGVIAQDINQASSFWRIREGIAEALMKAGAVYKYDLSLPVEKMYDLVEKMRQRLGETAKVIGYGHLGDGNLHLNISAPRYDDMIFAQIEPYVYEWTSEHRGSISAEHGLGLMKANKIFYSKSPKTVQLMSSIKKLLDPNGILNPYKV*PH*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKLMDKWRITNHLLKHSSKLLFDRRLSANSHNSVFRSALECSESLVKRGFGNASTIRYRCFGSEATKFERNAAFSTLNSEDVSYFKELLGEKSVIQDEDVLLAANEDWMRKYRGSSKLLLQPRTTNEILKYCNSRLLAVVPQGGNTGLVGGSVPVFDEVIINMGSMNNIITFDKGSGVLVCEAGCILENLVSFLDDHGFIMPLDLGAKGSCQIGGNVSTNAGGLRLVRYGSLHGNVLGLEAVLANGDVIDMLGTLRKDNTGYDLKHLFIGSEGSLGIVTKVSIHTPPKLSSVNLAFLACKDYFSCQKLLREAKRKLGEILSAFEFLDNQSMDLVLTYLEGVRNPFSSSMHNFYVLIETTGSEESYDREKLEAFLLSSMEGGLISDGVIAQDINQASSFWRIREGIAEALMKAGAVYKYDLSLPVEKMYDLVEKMRQRLGETAKVIGYGHLGDGNLHLNISAPRYDDMIFAQIEPYVYEWTSEHRGSISAEHGLGLMKANKIFYSKSPKTVQLMSSIKKLLDPNGILNPYKVLPHSLSNH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
D-2-hydroxyglutarate dehydrogenase, mitochondrial Catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate. May be involved in the catabolism of propionyl-CoA derived from beta-oxidation.confidentO23240
Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial Catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.confidentQ7XI14
D-2-hydroxyglutarate dehydrogenase, mitochondrial Catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.probableQ8N465

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PM9, chain A
Confidence level:very confident
Coverage over the Query: 77-533
View the alignment between query and template
View the model in PyMOL