Citrus Sinensis ID: 009326


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------
MVQRMAVSLRFALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGLLVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEFDNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILKPDNELRILIDGEEKQKANFLAADDFQPPLIPEKTIPDPDDKKPEDWDERAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLDDDPEEIDDPEATKPEDWDDEEDGEWEAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGSDGLAGFQTVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLFKIIFGGKKAKVEPPKETEAAESSSSKQEDSGEKEEETEKEETAAAPARRRRRDN
cHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccccEEccccccccEEEEEccccccccEEEEcccccccEEEEccccccccccccEEEEEEEEEcccccccccEEEEccccccccccccccccccEEEEEccccccccccEEEEEECccccccccccccccccccccccccccEEEEEEcccccEEEEEccEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEECcccccccEEEEcccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHcccccccccccc
*****AVSLRFALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGLLVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEFDNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILKPDNELRILIDGEEKQKANFLAADDFQPPLIP*********KKPEDWDERAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLDDDPEEIDDPEATKPEDWDDEEDGEWEAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKF****************DGLAGFQTVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLFKIIFGG************************************************
xxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQRMAVSLRFALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGLLVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEFDNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILKPDNELRILIDGEEKQKANFLAADDFQPPLIPEKTIPDPDDKKPEDWDERAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLDDDPEEIDDPEATKPEDWDDEEDGEWEAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGSDGLAGFQTVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLFKIIFGGKKAKVEPPKETEAAESSSSKQEDSGEKEEETEKEETAAAPARRRRRDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calnexin homolog Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.confidentQ39817
Calnexin homolog 1 Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.confidentP29402
Calnexin homolog Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.probableO82709

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHN, chain A
Confidence level:very confident
Coverage over the Query: 26-406
View the alignment between query and template
View the model in PyMOL