BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 009328
         (537 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1WID|A Chain A, Solution Structure Of The B3 Dna-Binding Domain Of Rav1
          Length = 130

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 2   NQSTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLR--G 59
           N S     L  +D++G  WRF++ +    + ++LT GWS FV  K L AGD   F R  G
Sbjct: 46  NVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNG 105

Query: 60  ENGELHVG 67
           ++ +L++G
Sbjct: 106 QDQQLYIG 113


>pdb|2B78|A Chain A, A Putative Sam-Dependent Methyltransferase From
           Streptococcus Mutans
 pdb|3LDF|A Chain A, Crystal Structure Of Smu.776, A Putative Methyltransferase
           Complexed With Sah
          Length = 385

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 9/71 (12%)

Query: 258 IDNHVAWHHKHSDFSSNSNFMSRTQSDGEWLTSPR-----VKFSQQLFQEAIDDNKNISA 312
           +DN V   +  +D    + ++S+      WL SP+     V +  +LFQ + D  KN   
Sbjct: 31  LDNQVVQLYSDADIFLGTAYLSKQNKGVGWLISPKKVSLNVTYFIKLFQWSKDKRKNF-- 88

Query: 313 WPAHSGHSTPH 323
             AHS  +T +
Sbjct: 89  --AHSKLTTAY 97


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,817,215
Number of Sequences: 62578
Number of extensions: 574364
Number of successful extensions: 1179
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1178
Number of HSP's gapped (non-prelim): 2
length of query: 537
length of database: 14,973,337
effective HSP length: 103
effective length of query: 434
effective length of database: 8,527,803
effective search space: 3701066502
effective search space used: 3701066502
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)