BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 009328
(537 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1WID|A Chain A, Solution Structure Of The B3 Dna-Binding Domain Of Rav1
Length = 130
Score = 48.5 bits (114), Expect = 1e-05, Method: Compositional matrix adjust.
Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
Query: 2 NQSTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLR--G 59
N S L +D++G WRF++ + + ++LT GWS FV K L AGD F R G
Sbjct: 46 NVSVKGVLLNFEDVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVSFSRSNG 105
Query: 60 ENGELHVG 67
++ +L++G
Sbjct: 106 QDQQLYIG 113
>pdb|2B78|A Chain A, A Putative Sam-Dependent Methyltransferase From
Streptococcus Mutans
pdb|3LDF|A Chain A, Crystal Structure Of Smu.776, A Putative Methyltransferase
Complexed With Sah
Length = 385
Score = 29.3 bits (64), Expect = 5.2, Method: Compositional matrix adjust.
Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 9/71 (12%)
Query: 258 IDNHVAWHHKHSDFSSNSNFMSRTQSDGEWLTSPR-----VKFSQQLFQEAIDDNKNISA 312
+DN V + +D + ++S+ WL SP+ V + +LFQ + D KN
Sbjct: 31 LDNQVVQLYSDADIFLGTAYLSKQNKGVGWLISPKKVSLNVTYFIKLFQWSKDKRKNF-- 88
Query: 313 WPAHSGHSTPH 323
AHS +T +
Sbjct: 89 --AHSKLTTAY 97
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.130 0.388
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,817,215
Number of Sequences: 62578
Number of extensions: 574364
Number of successful extensions: 1179
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1178
Number of HSP's gapped (non-prelim): 2
length of query: 537
length of database: 14,973,337
effective HSP length: 103
effective length of query: 434
effective length of database: 8,527,803
effective search space: 3701066502
effective search space used: 3701066502
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)