Citrus Sinensis ID: 009336
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 537 | ||||||
| 359481991 | 496 | PREDICTED: uncharacterized protein LOC10 | 0.782 | 0.846 | 0.638 | 1e-133 | |
| 297740082 | 372 | unnamed protein product [Vitis vinifera] | 0.636 | 0.919 | 0.692 | 1e-119 | |
| 224087397 | 497 | predicted protein [Populus trichocarpa] | 0.770 | 0.832 | 0.571 | 1e-110 | |
| 356548409 | 507 | PREDICTED: uncharacterized protein LOC10 | 0.700 | 0.741 | 0.577 | 1e-105 | |
| 356537087 | 507 | PREDICTED: uncharacterized protein LOC10 | 0.670 | 0.710 | 0.568 | 1e-101 | |
| 255575631 | 451 | protein with unknown function [Ricinus c | 0.541 | 0.645 | 0.659 | 1e-100 | |
| 449482360 | 511 | PREDICTED: uncharacterized protein LOC10 | 0.700 | 0.735 | 0.596 | 2e-99 | |
| 297833786 | 541 | tata-associated factor II 58 [Arabidopsi | 0.797 | 0.791 | 0.552 | 6e-99 | |
| 449451128 | 511 | PREDICTED: uncharacterized protein LOC10 | 0.700 | 0.735 | 0.583 | 2e-96 | |
| 18398741 | 539 | transcription initiation factor TFIID su | 0.797 | 0.794 | 0.539 | 1e-95 |
| >gi|359481991|ref|XP_002277150.2| PREDICTED: uncharacterized protein LOC100242486 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 481 bits (1239), Expect = e-133, Method: Compositional matrix adjust.
Identities = 292/457 (63%), Positives = 332/457 (72%), Gaps = 37/457 (8%)
Query: 104 RPWQPPQQHFSHFSSLPSSSSATPSTSASPPIPSPP--------RGGIAIGVPAPRPTAL 155
RPWQ Q HF HFSS SSSS++ ST + S RGGIAIGVPA +PT
Sbjct: 44 RPWQQ-QSHFQHFSSNLSSSSSSSSTPSLSTSTSSSAVSAPPSQRGGIAIGVPAGQPT-- 100
Query: 156 SPQPSPPFSS----SFGQPFGGLGRSGVNVPDSVRP-------PAIQG---MGVMGSLGS 201
PFSS +FGQ +GGLGRS VNVP+SV P+IQG MG+MG+LGS
Sbjct: 101 ------PFSSLNPPTFGQQYGGLGRSAVNVPESVANTNTSQVRPSIQGSQGMGMMGTLGS 154
Query: 202 SSQMRPAGISVQHHQPRPVQQSSLRPPPSSPSSQSPGTQNFQGQGLMRVSQVGSPGSSSP 261
SQMRP GIS HHQ RPVQ SSLRP S+ ++QSP TQNFQG GL+R S VGSPG+ SP
Sbjct: 155 GSQMRPGGISA-HHQQRPVQ-SSLRPQ-STVNNQSPATQNFQGHGLLRASSVGSPGAPSP 211
Query: 262 NTSQSVQSFNQPWLSSGSQGKPPLAPPSTYRPQMNTPSMQQRSHIPQQHS-PLST-NLQQ 319
NTSQS+Q NQPWLSSGSQGKPPL PS +RPQM S+ QRSHIPQQH PL T + QQ
Sbjct: 212 NTSQSMQPHNQPWLSSGSQGKPPLPSPS-FRPQMTAQSLPQRSHIPQQHHHPLPTASQQQ 270
Query: 320 QHLSSVQPQQSKPSHQLPDHYGQQFSSPRVPQSSPHQQQITRPPGSATQKPSSLALVQPN 379
Q ++ QPQQ SHQ +HYGQQF RVPQS PH QQI R GS QKPSSLA+VQP+
Sbjct: 271 QMSTAQQPQQPLLSHQQQEHYGQQFPPSRVPQSLPHPQQIGRVQGSGNQKPSSLAIVQPS 330
Query: 380 AVQTGNQSKIAGTESDEFGNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESI 439
Q G S+ A E+ E GNRIL+KRSI ELVNQIDPSE+LDP+VEDILVDIAEDFVESI
Sbjct: 331 TPQLGPHSRTASAEASESGNRILSKRSIHELVNQIDPSEKLDPEVEDILVDIAEDFVESI 390
Query: 440 TMFGCSLAKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPLVCDIHKERLAAI 499
T FGCSLAKHRKS TLEAKDIL+HLERNWNMTLPGF GDEIKTF+KP V DIHKERLAAI
Sbjct: 391 TTFGCSLAKHRKSPTLEAKDILLHLERNWNMTLPGFGGDEIKTFKKPFVSDIHKERLAAI 450
Query: 500 KKSVMATEVASARTTGGQAAASAKGNLGKMPANIIGS 536
KKS + TE A+ +++ GQ A + KG+ K AN++ S
Sbjct: 451 KKSAVGTESANTKSSSGQGAGNTKGHPAKTSANVLSS 487
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297740082|emb|CBI30264.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224087397|ref|XP_002308150.1| predicted protein [Populus trichocarpa] gi|222854126|gb|EEE91673.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356548409|ref|XP_003542594.1| PREDICTED: uncharacterized protein LOC100787779 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356537087|ref|XP_003537062.1| PREDICTED: uncharacterized protein LOC100781682 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255575631|ref|XP_002528715.1| protein with unknown function [Ricinus communis] gi|223531809|gb|EEF33627.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449482360|ref|XP_004156257.1| PREDICTED: uncharacterized protein LOC101226357 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297833786|ref|XP_002884775.1| tata-associated factor II 58 [Arabidopsis lyrata subsp. lyrata] gi|297330615|gb|EFH61034.1| tata-associated factor II 58 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449451128|ref|XP_004143314.1| PREDICTED: uncharacterized protein LOC101211513 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18398741|ref|NP_566367.1| transcription initiation factor TFIID subunit D10 [Arabidopsis thaliana] gi|6143870|gb|AAF04417.1|AC010927_10 unknown protein [Arabidopsis thaliana] gi|13492646|gb|AAK28289.1|AF344878_1 putative TBP-associated 58 kDa subunit protein [Arabidopsis thaliana] gi|39545904|gb|AAR28015.1| TAF12 [Arabidopsis thaliana] gi|62320727|dbj|BAD95394.1| hypothetical protein [Arabidopsis thaliana] gi|332641335|gb|AEE74856.1| transcription initiation factor TFIID subunit D10 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 537 | ||||||
| TAIR|locus:2100053 | 539 | TAF12 "TBP-associated factor 1 | 0.783 | 0.781 | 0.436 | 2.9e-80 | |
| TAIR|locus:2018861 | 683 | EER4 "ENHANCED ETHYLENE RESPON | 0.459 | 0.361 | 0.365 | 1.9e-33 | |
| UNIPROTKB|Q5ZKX3 | 161 | TAF12 "Uncharacterized protein | 0.260 | 0.869 | 0.450 | 1.4e-30 | |
| DICTYBASE|DDB_G0274697 | 627 | taf12 "TFIID subunit" [Dictyos | 0.249 | 0.213 | 0.455 | 2.1e-30 | |
| MGI|MGI:1913714 | 161 | Taf12 "TAF12 RNA polymerase II | 0.249 | 0.832 | 0.445 | 1e-29 | |
| RGD|1592841 | 161 | Taf12 "TAF12 RNA polymerase II | 0.255 | 0.850 | 0.434 | 1e-29 | |
| UNIPROTKB|Q3T174 | 161 | TAF12 "Transcription initiatio | 0.247 | 0.826 | 0.458 | 1.3e-29 | |
| ZFIN|ZDB-GENE-031030-5 | 162 | taf12 "TAF12 RNA polymerase II | 0.251 | 0.833 | 0.460 | 1.3e-29 | |
| UNIPROTKB|E2QVZ3 | 161 | TAF12 "Uncharacterized protein | 0.260 | 0.869 | 0.429 | 1.6e-29 | |
| UNIPROTKB|Q16514 | 161 | TAF12 "Transcription initiatio | 0.260 | 0.869 | 0.429 | 2.7e-29 |
| TAIR|locus:2100053 TAF12 "TBP-associated factor 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 806 (288.8 bits), Expect = 2.9e-80, P = 2.9e-80
Identities = 199/456 (43%), Positives = 234/456 (51%)
Query: 102 FSRPWQPPQQHFSHFXXXXXXXXXXXXXXXXXXXXX----XXRGGIAIGVPA-----PRP 152
+SRPWQ ++HF RGG+AIGVPA P P
Sbjct: 95 YSRPWQQ-HSSYTHFSSASSPLLSSSSAPASSSSSLPISGQQRGGMAIGVPASPIPSPSP 153
Query: 153 TALXXXXXXXXXXXXXXXXXXLGRSGVNVPDSVR---PPAI------QXXXXXXXXXXXX 203
T LGR V + ++ P + Q
Sbjct: 154 TP-SQHSPSAFPGSFGQQYGGLGRGTVGMSEATSNTSSPQVRMMQGTQGIGMMGTLGSGS 212
Query: 204 XXRPAGISVQHHXXXXXXXXXXXXXXXXXXXXXXGTQNFQGQGLMRXXXXXX-XXXXXXX 262
RP+G++ QH QNFQG LMR
Sbjct: 213 QIRPSGMT-QHQQRPTQSSLRPASSTSTQSPVA---QNFQGHSLMRPSPISSPNVQSTGA 268
Query: 263 XXXXXXXFNQPWLSSGSQGKPPLAPPSTYRPQMNTPSMQQRSHIPQQHSPLSTNLXXXXX 322
NQPWLSS QGKPPL PPS YRPQ+N+PSMQQR HIPQQH +ST+
Sbjct: 269 SQQSLQAINQPWLSSTPQGKPPLPPPS-YRPQVNSPSMQQRPHIPQQH--ISTS---AAT 322
Query: 323 XXXXXXXXKPSHQLPDHYGQQFSSPRVPQSSPHQQQITRPPGSATQKPSSLALV-QPNAV 381
+ HQ P QQ SP+ P + PHQ TR G QK +S + QP
Sbjct: 323 PQPQQQQSQQQHQ-PQEQLQQLRSPQQPLAHPHQP--TRVQGLVNQKVTSPVMPSQPPVA 379
Query: 382 QTGNQSKIAGTESDEFGNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITM 441
Q GN +K E++ +RIL KRSI EL+ QIDPSE+LDP+VEDIL DIAEDFVESIT
Sbjct: 380 QPGNHAKTVSAETEPSDDRILGKRSIHELLQQIDPSEKLDPEVEDILSDIAEDFVESITT 439
Query: 442 FGCSLAKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPLVCDIHKERLAAIKK 501
FGCSLAKHRKSD LEAKDIL+H+ERNWN+ PGFS DE KTFRKPL DIHKERLAAIKK
Sbjct: 440 FGCSLAKHRKSDILEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTTDIHKERLAAIKK 499
Query: 502 SVMATEVASARTTGGQAAASAKGNLGKMPANIIGST 537
SV ATE A+AR G A+A+G K P+N +GST
Sbjct: 500 SVTATEAANARNQFGHGTANARGGQAKTPSNPMGST 535
|
|
| TAIR|locus:2018861 EER4 "ENHANCED ETHYLENE RESPONSE 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZKX3 TAF12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0274697 taf12 "TFIID subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913714 Taf12 "TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1592841 Taf12 "TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T174 TAF12 "Transcription initiation factor TFIID subunit 12" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031030-5 taf12 "TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QVZ3 TAF12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16514 TAF12 "Transcription initiation factor TFIID subunit 12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00021654001 | SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (351 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00032691001 | • | • | • | 0.640 | |||||||
| GSVIVG00034077001 | • | • | 0.574 | ||||||||
| GSVIVG00014940001 | • | • | • | • | 0.551 | ||||||
| GSVIVG00018562001 | • | • | 0.456 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 537 | |||
| cd07981 | 72 | cd07981, TAF12, TATA Binding Protein (TBP) Associa | 4e-40 | |
| pfam03847 | 67 | pfam03847, TFIID_20kDa, Transcription initiation f | 2e-39 | |
| COG5624 | 505 | COG5624, TAF61, Transcription initiation factor TF | 9e-20 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 8e-12 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-07 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-06 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-06 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 7e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 7e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 8e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 9e-06 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 1e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-05 | |
| COG3889 | 872 | COG3889, COG3889, Predicted solute binding protein | 2e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-05 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 3e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-05 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 7e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 8e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 9e-05 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 1e-04 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 1e-04 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 2e-04 | |
| PRK13042 | 291 | PRK13042, PRK13042, superantigen-like protein; Rev | 2e-04 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| PRK13335 | 356 | PRK13335, PRK13335, superantigen-like protein; Rev | 3e-04 | |
| PRK11907 | 814 | PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl | 3e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-04 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 4e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-04 | |
| pfam11725 | 1771 | pfam11725, AvrE, Pathogenicity factor | 4e-04 | |
| pfam05086 | 910 | pfam05086, Dicty_REP, Dictyostelium (Slime Mold) R | 4e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 5e-04 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 5e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-04 | |
| PHA02638 | 417 | PHA02638, PHA02638, CC chemokine receptor-like pro | 6e-04 | |
| pfam01034 | 207 | pfam01034, Syndecan, Syndecan domain | 7e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 8e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.001 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.001 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.001 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 0.001 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.002 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.002 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.002 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.002 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.002 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 0.002 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.003 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 0.003 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 0.003 | |
| pfam05086 | 910 | pfam05086, Dicty_REP, Dictyostelium (Slime Mold) R | 0.004 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.004 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 0.004 | |
| PRK12495 | 226 | PRK12495, PRK12495, hypothetical protein; Provisio | 0.004 | |
| PRK12495 | 226 | PRK12495, PRK12495, hypothetical protein; Provisio | 0.004 | |
| pfam07267 | 606 | pfam07267, Nucleo_P87, Nucleopolyhedrovirus capsid | 0.004 |
| >gnl|CDD|173964 cd07981, TAF12, TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
Score = 139 bits (352), Expect = 4e-40
Identities = 45/72 (62%), Positives = 61/72 (84%)
Query: 401 ILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSLAKHRKSDTLEAKDI 460
ILTKR +QEL+ +IDP E+LDPDVE++L++IA+DFV+ + C LAKHRKSDTLE KD+
Sbjct: 1 ILTKRKLQELLKEIDPREQLDPDVEELLLEIADDFVDDVVEDACRLAKHRKSDTLEVKDV 60
Query: 461 LVHLERNWNMTL 472
+HLERNWN+++
Sbjct: 61 QLHLERNWNISI 72
|
The TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and are involved in forming the TFIID complex. TFIID is one of the seven General Transcription Factors (GTFs) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the pre-initiation complex. TFIID complex is composed of the TBP and at least 13 TAFs. TAFs are named after their electrophoretic mobility in polyacrylamide gels in different species. A new, unified nomenclature has been suggested for the pol II TAFs to show the relationship between TAF orthologs and paralogs. Several hypotheses are proposed for TAFs function such as serving as activator-binding sites, core-promoter recognition or a role in essential catalytic activity. These TAFs, with the help of specific activators, are required only for expression of a subset of genes and are not universally involved for transcription as are GTFs. In yeast and human cells, TAFs have been found as components of other complexes besides TFIID. Several TAFs interact via histone-fold (HFD) motifs; the HFD is the interaction motif involved in heterodimerization of the core histones and their assembly into nucleosome octamers. The minimal HFD contains three alpha-helices linked by two loops and is found in core histones, TAFs and many other transcription factors. TFIID has a histone octamer-like substructure. TAF12 domain interacts with TAF4 and makes a novel histone-like heterodimer that binds DNA and has a core promoter function of a subset of genes. Length = 72 |
| >gnl|CDD|112650 pfam03847, TFIID_20kDa, Transcription initiation factor TFIID subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|227911 COG5624, TAF61, Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226406 COG3889, COG3889, Predicted solute binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183854 PRK13042, PRK13042, superantigen-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|139494 PRK13335, PRK13335, superantigen-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221188 pfam11725, AvrE, Pathogenicity factor | Back alignment and domain information |
|---|
| >gnl|CDD|218421 pfam05086, Dicty_REP, Dictyostelium (Slime Mold) REP protein | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|165021 PHA02638, PHA02638, CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216257 pfam01034, Syndecan, Syndecan domain | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218421 pfam05086, Dicty_REP, Dictyostelium (Slime Mold) REP protein | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183558 PRK12495, PRK12495, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183558 PRK12495, PRK12495, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219355 pfam07267, Nucleo_P87, Nucleopolyhedrovirus capsid protein P87 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 537 | |||
| KOG1142 | 258 | consensus Transcription initiation factor TFIID, s | 100.0 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 99.96 | |
| COG5624 | 505 | TAF61 Transcription initiation factor TFIID, subun | 99.95 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 99.92 | |
| PLN00035 | 103 | histone H4; Provisional | 98.78 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 98.72 | |
| PTZ00015 | 102 | histone H4; Provisional | 98.71 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 98.54 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 98.31 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 98.27 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 98.18 | |
| smart00417 | 74 | H4 Histone H4. | 98.13 | |
| smart00428 | 105 | H3 Histone H3. | 98.05 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 98.05 | |
| KOG3467 | 103 | consensus Histone H4 [Chromatin structure and dyna | 98.05 | |
| PLN00161 | 135 | histone H3; Provisional | 97.84 | |
| PLN00121 | 136 | histone H3; Provisional | 97.72 | |
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 97.64 | |
| PTZ00018 | 136 | histone H3; Provisional | 97.6 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 97.53 | |
| PLN00160 | 97 | histone H3; Provisional | 97.46 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 97.37 | |
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 97.33 | |
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 97.13 | |
| smart00427 | 89 | H2B Histone H2B. | 97.01 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 96.89 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 96.75 | |
| PLN00158 | 116 | histone H2B; Provisional | 96.64 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 96.56 | |
| PTZ00463 | 117 | histone H2B; Provisional | 96.55 | |
| KOG3334 | 148 | consensus Transcription initiation factor TFIID, s | 96.49 | |
| cd07978 | 92 | TAF13 The TATA Binding Protein (TBP) Associated Fa | 96.4 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 96.32 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 95.88 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 95.74 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 95.73 | |
| KOG3423 | 176 | consensus Transcription initiation factor TFIID, s | 95.43 | |
| KOG1744 | 127 | consensus Histone H2B [Chromatin structure and dyn | 95.38 | |
| KOG2549 | 576 | consensus Transcription initiation factor TFIID, s | 95.37 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 94.63 | |
| KOG0870 | 172 | consensus DNA polymerase epsilon, subunit D [Trans | 94.22 | |
| KOG1745 | 137 | consensus Histones H3 and H4 [Chromatin structure | 93.77 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 93.62 | |
| PF05236 | 264 | TAF4: Transcription initiation factor TFIID compon | 93.58 | |
| PF03540 | 51 | TFIID_30kDa: Transcription initiation factor TFIID | 93.49 | |
| cd08045 | 212 | TAF4 TATA Binding Protein (TBP) Associated Factor | 93.4 | |
| COG5094 | 145 | TAF9 Transcription initiation factor TFIID, subuni | 93.35 | |
| COG5150 | 148 | Class 2 transcription repressor NC2, beta subunit | 91.11 | |
| COG5248 | 126 | TAF19 Transcription initiation factor TFIID, subun | 90.67 | |
| KOG3901 | 109 | consensus Transcription initiation factor IID subu | 90.27 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 88.63 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 87.63 | |
| COG5162 | 197 | Transcription initiation factor TFIID, subunit TAF | 87.34 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 87.18 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 87.0 | |
| COG5095 | 450 | TAF6 Transcription initiation factor TFIID, subuni | 86.72 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 84.91 | |
| smart00414 | 106 | H2A Histone 2A. | 84.66 | |
| KOG3219 | 195 | consensus Transcription initiation factor TFIID, s | 84.23 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 81.72 | |
| KOG2680 | 454 | consensus DNA helicase TIP49, TBP-interacting prot | 81.63 | |
| KOG4336 | 323 | consensus TBP-associated transcription factor Prod | 81.56 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 81.22 |
| >KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.9e-54 Score=417.58 Aligned_cols=231 Identities=36% Similarity=0.492 Sum_probs=181.4
Q ss_pred cccCccccccCCCCCCCCCCCCCCCCCCCCcccccccCCcccCCCCcchhhhhhcccccCCCCCCCCCCccccccccCC-
Q 009336 268 QSFNQPWLSSGSQGKPPLAPPSTYRPQMNTPSMQQRSHIPQQHSPLSTNLQQQHLSSVQPQQSKPSHQLPDHYGQQFSS- 346 (537)
Q Consensus 268 Q~~~Q~WL~~~~q~~p~l~sp~s~r~q~~~~~~QQr~h~~qQ~~~~~t~lqqqqlsq~qqqq~~~~~q~q~h~~qQ~~~- 346 (537)
|..+++||+.+..+.++...| ++|+|++.+.+.+|.++.+|+-+..- .+.+. ....+...+..++|+. ++..
T Consensus 25 q~~qq~~~~~~~~~~s~~~~~-s~~~q~~~~~~~~~~~~~qq~~s~~~--~~~~~---~n~~~~s~~~~~~~~~-~~~~~ 97 (258)
T KOG1142|consen 25 QARQQQWLRQIQGIPSPESYP-SQRQQRFSPTCSIRENPNQQWISTGY--PQPQV---SNGGPPSQALNQQDSQ-QSAIS 97 (258)
T ss_pred HHHHhhhhccccCCCCCCCCh-hhccccCCCcccccCCCCcccccccc--Ccccc---ccCCchHHhhhhhhHH-hhccc
Confidence 455889999999888888886 99999999999999888888854432 11111 1111111122223333 2222
Q ss_pred -CCCCCCCccccccCCCCCCCCCCcccccc-CCCCccccCCCCccCCCCCCCcCCccCCHHHHHHHHHhhCCCCCCCHHH
Q 009336 347 -PRVPQSSPHQQQITRPPGSATQKPSSLAL-VQPNAVQTGNQSKIAGTESDEFGNRILTKRSIQELVNQIDPSERLDPDV 424 (537)
Q Consensus 347 -~~~~~~~~~qqq~~r~~~~~~qk~~sl~~-sqp~~~~~g~~~~~~~~~~~e~~nrILtKrKLqELVrqIDP~e~LD~DV 424 (537)
.+.++....+....+++....++...-.. ++......+++.++..+..++++++||.|+||+|||++||++++||+||
T Consensus 98 ~~q~P~~~~~q~~~~~~~~~~~~~~~~P~~~~~g~~~g~~~sp~~s~s~~~~~~~~il~k~kl~dLvqqId~~~~LD~dV 177 (258)
T KOG1142|consen 98 QQQQPASSPSQGSSMSNQTSSVQKDPAPVIGSQGSVSGGGTSPAGSSSQDEPGNNPILSKRKLDDLVQQIDGTTKLDDDV 177 (258)
T ss_pred cCCCCccCCCCCCCccccCcccccCCCCCCCCCCccCCCCCCCCcccccccCCCCccccccchhHHHHhhcCcccccHHH
Confidence 34455555566666777777776654433 2233333445556777788999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhhhhcCCCCcchhhHHHHHhhccCcccCCCCcccccccCCCCCchHHHHHHHHHHHHhh
Q 009336 425 EDILVDIAEDFVESITMFGCSLAKHRKSDTLEAKDILVHLERNWNMTLPGFSGDEIKTFRKPLVCDIHKERLAAIKKSVM 504 (537)
Q Consensus 425 EELLLeIADDFVDsVvs~ACkLAKHRKSdTLEvKDVQLhLERnWNI~IPGfssDEIR~~RK~~pTEaHKQRMALIRKsI~ 504 (537)
||+||||||||||+|++|+|+||||||+++||+|||+|||||+|||+||||++||++.|||+.++|+||+|||+|||.++
T Consensus 178 edlLleiADdFV~sii~~sC~LAKHRKsdtlEvrDIqLhLEr~~Nm~iPgf~sd~~~~~~k~~pTe~hkqr~a~i~k~~~ 257 (258)
T KOG1142|consen 178 EDLLLEIADDFVSSIIHRSCKLAKHRKSDTVEVRDIQLHLERNFNMEIPGFSSDEKRSKKKALPTEEHKQRLALIRKQIK 257 (258)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhcccCccchhheeeeeeccccccCCCccccccccccccCCcHHHHHHHHHHHHhhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999886
Q ss_pred h
Q 009336 505 A 505 (537)
Q Consensus 505 s 505 (537)
.
T Consensus 258 k 258 (258)
T KOG1142|consen 258 K 258 (258)
T ss_pred C
Confidence 3
|
|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >COG5624 TAF61 Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >KOG3467 consensus Histone H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >KOG3423 consensus Transcription initiation factor TFIID, subunit TAF10 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG1744 consensus Histone H2B [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] | Back alignment and domain information |
|---|
| >KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site | Back alignment and domain information |
|---|
| >PF03540 TFIID_30kDa: Transcription initiation factor TFIID 23-30kDa subunit; InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors | Back alignment and domain information |
|---|
| >cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >COG5248 TAF19 Transcription initiation factor TFIID, subunit TAF13 [Transcription] | Back alignment and domain information |
|---|
| >KOG3901 consensus Transcription initiation factor IID subunit [Transcription] | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >COG5162 Transcription initiation factor TFIID, subunit TAF10 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] | Back alignment and domain information |
|---|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >KOG4336 consensus TBP-associated transcription factor Prodos [Transcription] | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 537 | ||||
| 1h3o_B | 76 | Crystal Structure Of The Human Taf4-Taf12 (Tafii135 | 1e-19 |
| >pdb|1H3O|B Chain B, Crystal Structure Of The Human Taf4-Taf12 (Tafii135-Tafii20) Complex Length = 76 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 537 | |||
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 4e-43 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-11 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 8e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 2e-09 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 1e-08 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 3e-07 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-07 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 8e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 7e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 6e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 8e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 6e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 7e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 8e-06 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 2e-05 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 2e-05 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 6e-04 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 6e-04 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 7e-04 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 6e-05 |
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Length = 76 | Back alignment and structure |
|---|
Score = 146 bits (371), Expect = 4e-43
Identities = 40/75 (53%), Positives = 59/75 (78%)
Query: 398 GNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSLAKHRKSDTLEA 457
+ +LTK+ +Q+LV ++DP+E+LD DVE++L+ IA+DF+ES+ C LA+HRKS TLE
Sbjct: 2 SHMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEV 61
Query: 458 KDILVHLERNWNMTL 472
KD+ +HLER WNM +
Sbjct: 62 KDVQLHLERQWNMWI 76
|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 537 | |||
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 100.0 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 98.99 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 98.94 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 98.89 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 98.85 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 98.75 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 98.64 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 98.62 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 98.62 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 98.45 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 98.39 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.39 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 98.37 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 98.24 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 98.19 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 98.18 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 98.15 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 98.15 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 98.12 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 98.09 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 98.09 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 98.02 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 97.98 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 97.97 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 97.9 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 97.88 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 97.82 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 97.68 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 97.6 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 97.54 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 97.46 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 97.37 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 97.32 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 97.3 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 97.08 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 97.04 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 96.97 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 96.65 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 96.57 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 96.55 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 96.52 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 96.49 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 96.25 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 96.17 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 95.85 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 95.82 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 93.32 | |
| 3v9r_B | 88 | MHF2, uncharacterized protein YDL160C-A; histone f | 91.81 | |
| 1h3o_A | 75 | Transcription initiation factor TFIID 135 kDa subu | 90.78 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 90.12 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 89.75 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 89.69 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 88.83 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 88.32 | |
| 3aji_B | 83 | S6C, proteasome (prosome, macropain) 26S subunit, | 86.63 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 85.32 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 84.19 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 83.83 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 83.62 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 83.13 | |
| 3vlf_B | 88 | 26S protease regulatory subunit 7 homolog; heat re | 83.11 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 82.63 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 82.56 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 81.18 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 80.83 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 80.82 |
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-33 Score=230.13 Aligned_cols=75 Identities=53% Similarity=0.960 Sum_probs=73.1
Q ss_pred CCccCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCcchhhHHHHHhhccCccc
Q 009336 398 GNRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSLAKHRKSDTLEAKDILVHLERNWNMTL 472 (537)
Q Consensus 398 ~nrILtKrKLqELVrqIDP~e~LD~DVEELLLeIADDFVDsVvs~ACkLAKHRKSdTLEvKDVQLhLERnWNI~I 472 (537)
.++||+|++|++||++|||++.||+||||+|++|||||||+|+++||+||||||+++||+|||+|||||+|||+|
T Consensus 2 s~~vl~k~~L~~Lv~~idp~~~ld~~vee~ll~lADdFV~~V~~~ac~lAKhR~s~~le~kDvql~Ler~wni~i 76 (76)
T 1h3o_B 2 SHMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI 76 (76)
T ss_dssp -CCSSCHHHHHHHHHHHCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEECHHHHHHHHHHHTCCCC
T ss_pred CcccccHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCccHHHHHHHHHhhcCCcC
Confidence 578999999999999999999999999999999999999999999999999999999999999999999999997
|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1h3o_A Transcription initiation factor TFIID 135 kDa subunit; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 537 | ||||
| d1h3ob_ | 74 | a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), hi | 2e-44 | |
| d1htaa_ | 68 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth | 2e-06 | |
| d1ku5a_ | 66 | a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc | 5e-06 | |
| d2huec1 | 82 | a.22.1.1 (C:20-101) Histone H4 {African clawed fro | 5e-06 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 9e-06 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 7e-05 |
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: TBP-associated factors, TAFs domain: TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 149 bits (378), Expect = 2e-44
Identities = 40/74 (54%), Positives = 59/74 (79%)
Query: 399 NRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSLAKHRKSDTLEAK 458
+ +LTK+ +Q+LV ++DP+E+LD DVE++L+ IA+DF+ES+ C LA+HRKS TLE K
Sbjct: 1 HMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVK 60
Query: 459 DILVHLERNWNMTL 472
D+ +HLER WNM +
Sbjct: 61 DVQLHLERQWNMWI 74
|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 82 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 537 | |||
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 100.0 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 98.83 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 98.69 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 98.44 | |
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 98.11 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.11 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.09 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 97.97 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 97.87 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 97.75 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 97.67 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 97.5 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 97.13 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 96.84 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 96.68 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 96.36 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 95.34 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.44 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.18 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 92.0 | |
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 87.09 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 84.75 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 83.39 |
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: TBP-associated factors, TAFs domain: TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=8.7e-34 Score=230.59 Aligned_cols=74 Identities=54% Similarity=0.971 Sum_probs=72.8
Q ss_pred CccCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCcchhhHHHHHhhccCccc
Q 009336 399 NRILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESITMFGCSLAKHRKSDTLEAKDILVHLERNWNMTL 472 (537)
Q Consensus 399 nrILtKrKLqELVrqIDP~e~LD~DVEELLLeIADDFVDsVvs~ACkLAKHRKSdTLEvKDVQLhLERnWNI~I 472 (537)
++||+|++|+|||++||+++.||+||||+|++|||||||+|+++||+||||||+++||+|||+|||||+|||+|
T Consensus 1 ~~il~K~~L~eLv~~idp~~~ld~~vee~ll~iADdFV~~V~~~ac~lAKhR~s~~le~kDvql~LeR~wNm~i 74 (74)
T d1h3ob_ 1 HMVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWI 74 (74)
T ss_dssp CCSSCHHHHHHHHHHHCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEECHHHHHHHHHHHTCCCC
T ss_pred CccccHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCcHHHHHHHHHhhcCccC
Confidence 57999999999999999999999999999999999999999999999999999999999999999999999997
|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|