Citrus Sinensis ID: 009347

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------

MAFFASQTSAVAAILTLIIFLYTLLLFVSRNYASNKKKRGPPEAGGAWPVIGHLHLLGRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYDFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNAILRVTVGQRCNSSSSQEDTDHEGAWKEELTKFFAFSGKFVVSDSLPFLRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDFMDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLYG

cccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEcccccEEEEccHHHHHHHHHHccccccccccHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccccccccccccccEEccEEcccccEEEEEHHHccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEECcccccccc

*******TSAVAAILTLIIFLYTLLLFVSRNYA***********GGAWPVIGHLHLLGRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYDFWERT************KVLVEMNKWFEDVTLNAILRVTVGQRCNSS******DHEGAWKEELTKFFAFSGKFVVSDSLPFLRWFDIGGDERAMKKNARELDVLAQGWLD*******************FMDVMLSILRDD***LPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLY*

xxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAFFASQTSAVAAILTLIIFLYTLLLFVSRNYASNKKKRGPPEAGGAWPVIGHLHLLGRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLKELYDFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNAILRVTVGQRCNSSSSQEDTDHEGAWKEELTKFFAFSGKFVVSDSLPFLRWFDIGGDERAMKKNARELDVLAQGWLDEHKRKRESGQMINKEGHEDFMDVMLSILRDDAQQLPGDDADTINKATCLALILAASDTSKITLTWILSLLLNHRDVxxxxxxxxxxxxxxxxxxxxxDIKNLVYLQAIIKEAMRLYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHKHIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMSLTLVKTTPVKVLITPRLSASLYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome P450 82C4	Can hydroxylates 8-methoxypsoralen to form 5-hydroxy-8-methoxypsoralen in vivo and in vitro. Involved in the early iron deficiency response, possibly through an IDE1-like mediated pathway.	probable	Q9SZ46

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PM0, chain A
Confidence level:very confident
Coverage over the Query: 59-535
View the alignment between query and template
View the model in PyMOL

Template: 3RUK, chain A
Confidence level:confident
Coverage over the Query: 59-183,201-530
View the alignment between query and template
View the model in PyMOL