Citrus Sinensis ID: 009364

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530------
MQDLFGSVRRSIVFRTTAESTTDAQTANSPTPFSGGNLVERFNSCIRNSRVLSKHISPSVKMSPPIRWRKGELIGCGAFGRVYMGMNLDSGELLAVKQVLIAANFASKEKAQDHIKELEEEVKLLKDLSHPNIVRYLGTVREEESLNILLEFVPGGSISSLLGKFGPFPEAVMRTYTKQLLLGLEYLHNHGIMHRDIKGANILVDNKGCIKLADFGASKQVAELATVSGAKSMKGTPYWMAPEVIRQTGHSYSADIWSVGCTVIEMATGKPPWSQQYQEVAALFHIGTTKSHPPIPENLSVKAKDFLLKCLEKEPDLRPTASELLKHPFVTGDDEDPVLHASVMKSSEILSPSHVANLESLQMLTSPGSPGSVDICNLDSLSCSRVIVEKLSGSMHGWVTSNSNDDLCQLDQEDFVAGDRKLSSILAPNDLEKSRNPMCEPSDDWRWKFDGSPEPEKNELKPDSDESLKVPASRINASGEEDNGFSFPRGTPLSEDDDELTESKIKAFLDAKVLVCIRIGLFVVMLNLIYITLMMH
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccECcccccccEEEEEEcccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccCEEEcEEECccEEEEEEECcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccEEEccccccccccccccccccccccccccccccHHHcccccccccccccHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHccc
***********************************************************VKMSPPIRWRKGELIGCGAFGRVYMGMNLDSGELLAVKQVLIAANFASKE****HIKELEEEVKLLKDLSHPNIVRYLGTVREEESLNILLEFVPGGSISSLLGKFGPFPEAVMRTYTKQLLLGLEYLHNHGIMHRDIKGANILVDNKGCIKLADFGASKQVAELATVSGAKSMKGTPYWMAPEVIRQTGHSYSADIWSVGCTVIEMATGKPPWSQQYQEVAALFHIGTTKSHPPIPENLSVKAKDFLLKCLEKEPDLRPTASELLKHPFVT*****************************************VDICNLDSLSCSRVIVEKLSGSMHGWVTSNSNDDLCQLDQEDFVA*********************************************************************************ELTESKIKAFLDAKVLVCIRIGLFVVMLNLIYITLMMH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDLFGSVRRSIVFRTTAESTTDAQTANSPTPFSGGNLVERFNSCIRNSRVLSKHISPSVKMSPPIRWRKGELIGCGAFGRVYMGMNLDSGELLAVKQVLxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHPNIVRYLGTVREEESLNILLEFVPGGSISSLLGKFGPFPEAVMRTYTKQLLLGLEYLHNHGIMHRDIKGANILVDNKGCIKLADFGASKQVAELATVSGAKSMKGTPYWMAPEVIRQTGHSYSADIWSVGCTVIEMATGKPPWSQQYQEVAALFHIGTTKSHPPIPENLSVKAKDFLLKCLEKEPDLRPTASELLKHPFVTGDDEDPVLHASVMKSSEILSPSHVANLESLQMLTSPGSPGSVDICNLDSLSCSRVIVEKLSGSMHGWVTSNSNDDLCQLDQEDFVAGDRKLSSILAPNDLEKSRNPMCEPSDDWRWKFDGSPEPEKNELKPDSDESLKVPASRINASGEEDNGFSFPRGTPLSEDDDELTESKIKAFLDAKVLVCIRIGLFVVMLNLIYITLMMH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitogen-activated protein kinase kinase kinase ANP1 May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6. May suppress auxin signaling that promotes cell cycle. Functionally redundant to ANP2 and ANP3 in the positive regulation of cytokinesis.probableO22040
Mitogen-activated protein kinase kinase kinase 2 Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule-associated proteins such as MAP65-1.probableQ9FZ36

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CLQ, chain A
Confidence level:very confident
Coverage over the Query: 68-332
View the alignment between query and template
View the model in PyMOL
Template: 3Q5I, chain A
Confidence level:very confident
Coverage over the Query: 64-101,113-438
View the alignment between query and template
View the model in PyMOL