BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 009396
(535 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|O62479|SAS6_CAEEL Spindle assembly abnormal protein 6 OS=Caenorhabditis elegans
GN=sas-6 PE=1 SV=1
Length = 492
Score = 34.3 bits (77), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 20/45 (44%), Positives = 30/45 (66%), Gaps = 3/45 (6%)
Query: 17 CSELESKCLELESEIEKK---KTQFEKLEQKFKELEDEKNGIEEE 58
+ L KC +LE ++EK K +FE++ +KFKELEDE ++EE
Sbjct: 197 LASLRQKCGDLEKQVEKLSGVKEEFEEMSEKFKELEDEVELVKEE 241
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.307 0.128 0.352
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 209,525,104
Number of Sequences: 539616
Number of extensions: 9834131
Number of successful extensions: 67110
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 503
Number of HSP's successfully gapped in prelim test: 1986
Number of HSP's that attempted gapping in prelim test: 48234
Number of HSP's gapped (non-prelim): 12256
length of query: 535
length of database: 191,569,459
effective HSP length: 122
effective length of query: 413
effective length of database: 125,736,307
effective search space: 51929094791
effective search space used: 51929094791
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 64 (29.3 bits)