Citrus Sinensis ID: 009406


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----
MTAIATAAALSLPISLYRPAKINTKKSVRGGFRVFALFGEEGGLVDKKSAWSTLFDVEDPRSKVPQCKGKFLDVNQALEVARYDIQYCDWRARQDVLTIMLLHEKVVEVLNPLARDYKSIGTMKKELAELQEDLAQAHRQVHISEARVATALDKLAYMEALVNDRLLQDRHTSGTDQTCASPSTSKQSLDIVKGKLPRKSLNVSGPVQPYNTRLKNFWFPVAFSTDLKDDTMVPFDCFEEPWVIFRGKDGIPGCVQNTCAHRACPLHLGSVNEGRIQCPYHGWEYSTDGKCEKMPSTQLRNVKIKSLPCFEQEGMIWIWPGDEPPTATIPCLLPPSGFEIHAEIVMELPIEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPASGLQGYWDPYPIDMEFRPPCMVLSTIGISKPGKLEGQNTRQCATHLHQLHVCLPSSRKKTRLLYRMSLDFASVLKHVPFMQYLWRHFAEQVLNEDLRLVLGQQERMNNGANVWNLPVGYDKLGVRYRLWRDALEKGAKQLPFMKPM
cHHHHHHHHccccEEccccccccccccccccEEEEEEEcccccccccccccEEEEECcccccccccccccEEcHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEECcccccccccccCEECccCEEEEEcccccEEEEEcccccccccccccEECccEEEcccccEEEcccccEEEccccccccccccEEEEEEEccEEEEEccccccccccccccccccccEEEEEEEEEEcccHHHHHHHccccccccccccccccccccccccEEECccccccCECccccccEEECccCEEEEEEEECcccccccccccccccEEEEEEEEECccccCEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccccc
*****TAAALSLPISLYRPAKINTKKSVRGGFRVFALFGEEGGLVDKKSAWSTLFDVEDPRSKVPQCKGKFLDVNQALEVARYDIQYCDWRARQDVLTIMLLHEKVVEVLNPLARDYKSIGTMKKELAELQEDLAQAHRQVHISEARVATALDKLAYMEALVNDRLL******************************************YNTRLKNFWFPVAFSTDLKDDTMVPFDCFEEPWVIFRGKDGIPGCVQNTCAHRACPLHLGSVNEGRIQCPYHGWEYSTDGKCEKMPSTQLRNVKIKSLPCFEQEGMIWIWPGDEPPTATIPCLLPPSGFEIHAEIVMELPIEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPASGLQGYWDPYPIDMEFRPPCMVLSTIGISKPGKLEGQNTRQCATHLHQLHVCLPSSRKKTRLLYRMSLDFASVLKHVPFMQYLWRHFAEQVLNEDLRLVLGQQERMNNGANVWNLPVGYDKLGVRYRLWRDALE********MKP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAIATAAALSLPISLYRPAKINTKKSVRGGFRVFALFGEEGGLVDKKSAWSTLFDVEDPRSKVPQCKGKFLDVNQALEVARYDIQYCDWRARQDVLTIMLLHEKVVEVLNPLARDYKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxVATALDKLAYMEALVNDRLLQDRHTSGTDQTCASPSTSKQSLDIVKGKLPRKSLNVSGPVQPYNTRLKNFWFPVAFSTDLKDDTMVPFDCFEEPWVIFRGKDGIPGCVQNTCAHRACPLHLGSVNEGRIQCPYHGWEYSTDGKCEKMPSTQLRNVKIKSLPCFEQEGMIWIWPGDEPPTATIPCLLPPSGFEIHAEIVMELPIEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPASGLQGYWDPYPIDMEFRPPCMVLSTIGISKPGKLEGQNTRQCATHLHQLHVCLPSSRKKTRLLYRMSLDFASVLKHVPFMQYLWRHFAEQVLNEDLRLVLGQQERMNNGANVWNLPVGYDKLGVRYRLWRDALEKGAKQLPFMKPM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chlorophyllide a oxygenase, chloroplastic Catalyzes a two-step oxygenase reaction involved in the synthesis of chlorophyll b. Acts specifically on the non-esterified chlorophyllide a and not on chlorophyll a.confidentQ8S7E1
Chlorophyllide a oxygenase, chloroplastic Catalyzes a two-step oxygenase reaction involved in the synthesis of chlorophyll b. Acts specifically on the non-esterified chlorophyllide a and not on chlorophyll a.confidentQ9MBA1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.13.-.-Acting on single donors with incorporation of molecular oxygen.probable
1.13.12.-With incorporation of one atom of oxygen.probable
1.13.12.14Transferred entry: 1.14.13.122.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GKE, chain A
Confidence level:very confident
Coverage over the Query: 211-528
View the alignment between query and template
View the model in PyMOL
Template: 3N0Q, chain A
Confidence level:very confident
Coverage over the Query: 176-197,215-415,433-523
View the alignment between query and template
View the model in PyMOL
Template: 4AAY, chain B
Confidence level:confident
Coverage over the Query: 207-319
View the alignment between query and template
View the model in PyMOL