BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 009416
         (535 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGK|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And An
           Incomplete Jaz1 Degron
 pdb|3OGL|B Chain B, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|D Chain D, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|F Chain F, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|H Chain H, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|J Chain J, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|L Chain L, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|N Chain N, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGL|P Chain P, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine And
           The Jaz1 Degron
 pdb|3OGM|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
 pdb|3OGM|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And The
           Jaz1 Degron
          Length = 592

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 5/68 (7%)

Query: 129 RNLPEIIFYVESLHVLELSYCKLQQPSENVKLFSLRKLALREVCADDQAIASLISGCPLI 188
           + L    FY+    + +L    + Q S NV     R + L  V   D+ +     GCP +
Sbjct: 436 KKLRRFAFYLRQGGLTDLGLSYIGQYSPNV-----RWMLLGYVGESDEGLMEFSRGCPNL 490

Query: 189 EYLEIRSC 196
           + LE+R C
Sbjct: 491 QKLEMRGC 498


>pdb|2FTS|A Chain A, Crystal Structure Of The Glycine Receptor-Gephyrin Complex
 pdb|2FU3|A Chain A, Crystal Structure Of Gephyrin E-Domain
 pdb|2FU3|B Chain B, Crystal Structure Of Gephyrin E-Domain
          Length = 419

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 466 QLIYDGEIPRCCQSLPVSCWQHCINEVKVEHTKSLSITEDGELQHDVRSYYCFEGGEDI 524
           Q +  G++ R     P+ C    +  V+VE T+ +  ++DG  + +VR       G+DI
Sbjct: 84  QTVMPGQVMRVTTGAPIPCGADAV--VQVEDTELIRESDDGTEELEVRILVQARPGQDI 140


>pdb|2NRT|A Chain A, Crystal Structure Of The C-Terminal Half Of Uvrc
 pdb|2NRV|A Chain A, Crystal Structure Of The C-Terminal Half Of Uvrc
 pdb|2NRV|B Chain B, Crystal Structure Of The C-Terminal Half Of Uvrc
 pdb|2NRW|A Chain A, Crystal Structure Of The C Terminal Half Of Uvrc
 pdb|2NRX|A Chain A, Crystal Structure Of The C-Terminal Half Of Uvrc, In The
           Presence Of Sulfate Molecules
 pdb|2NRX|B Chain B, Crystal Structure Of The C-Terminal Half Of Uvrc, In The
           Presence Of Sulfate Molecules
 pdb|2NRZ|A Chain A, Crystal Structure Of The C-terminal Half Of Uvrc Bound To
           Its Catalytic Divalent Cation
 pdb|2NRZ|B Chain B, Crystal Structure Of The C-terminal Half Of Uvrc Bound To
           Its Catalytic Divalent Cation
          Length = 220

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 10/112 (8%)

Query: 347 FSSHLMVN-------IEWVVEYFEILAMFQKFSKVLNLQCREGENVIVPQELRQIQSPPL 399
           +S H + N       I  V    E L    K   V+ L  +E E V+   E R+I  P  
Sbjct: 79  YSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKE-ETVVF--ENREIHLPHD 135

Query: 400 TSVKKLNYSVRTDSWDFSVANVRARSSRFSIANVLDGLLWTSPHAEMVSIEH 451
             V +L   +R ++  F+V+  R R  + S+ +VLD +    P  +   IEH
Sbjct: 136 HPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEH 187


>pdb|1T3E|A Chain A, Structural Basis Of Dynamic Glycine Receptor Clustering
 pdb|1T3E|B Chain B, Structural Basis Of Dynamic Glycine Receptor Clustering
          Length = 421

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 466 QLIYDGEIPRCCQSLPVSCWQHCINEVKVEHTKSLSITEDGELQHDVRSYYCFEGGEDI 524
           Q +  G++ R     P+ C    +  V+VE T+ +  ++DG  + +VR       G+DI
Sbjct: 86  QTVMPGQVMRVTTGAPIPCGADAV--VQVEDTELIRESDDGTEELEVRILVQARPGQDI 142


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,077,410
Number of Sequences: 62578
Number of extensions: 582963
Number of successful extensions: 1264
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1259
Number of HSP's gapped (non-prelim): 14
length of query: 535
length of database: 14,973,337
effective HSP length: 103
effective length of query: 432
effective length of database: 8,527,803
effective search space: 3684010896
effective search space used: 3684010896
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)