Citrus Sinensis ID: 009439

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-----
MAEVKLEEECCLENKQLTAASSSSLSEGSSSAILKSPGVSSPATTSPTHRRTTGPIRRAKGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKSSLQNGTKDTSQSTATENLVCSNKDSDSAAQTSSGTTDIGKPDEEGGKDRLEPSALVPDMATSSSIRPNESMDSEGLECNPESPNIDLTCSESMPRLENCTVNCEFVEDKVTGTQKQVGTPTYGSLYYVPPELKSFILLDKDTSNRHSVHHDYNSSPITSPISFFTPPCVKGSGLSSPSPESILKIAAKTFPYTPSIFRKRKPVSQVQLDANKIGKVDGESGSDRFCLSGKQESNQNNSKNSRFQDASPSGSIEPTGMTFNASPPYRLRSKRTAVFKSVERQLEFTSNKEKGDRNANFVKPSVKGTSH
cHHHHHHHHHHHHcccHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccc
cccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccEcccccccHHHHHHHHHHHHHHccccHHHHHcccccccHHcHHHHHHcccccccccccccHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHcccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccHHHcccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccc
MAEVKLEEECclenkqltaasssslsegsssailkspgvsspattspthrrttgpirrakggwtpeedETLRNAVSTFKGKSWKKIAEffpdrsevqCLHRWqkvlnpdlvkgpwtqeeDDKITELVSKYGPTKWSVIAkslpgrigkqCRERWhnhlnpdikkDAWTLEEELALMNAHRIHGNKWAEIAKvlpgrtdnsiknhwnsSLKKKLDFYLatgklppvaksslqngtkdtsqstatenlvcsnkdsdsaaqtssgttdigkpdeeggkdrlepsalvpdmatsssirpnesmdseglecnpespnidltcsesmprlenctvncefvedkvtgtqkqvgtptygslyyvppelksfilldkdtsnrhsvhhdynsspitspisfftppcvkgsglsspspeSILKIAAktfpytpsifrkrkpvsqvqldankigkvdgesgsdrfclsgkqesnqnnsknsrfqdaspsgsieptgmtfnasppyrlrskrtAVFKSVERQLeftsnkekgdrnanfvkpsvkgtsh
MAEVKLEEECCLENKQLTAASSSSLSEGsssailkspgvsspattspthrrttgpirrakggwtpeedetlrnavstfkgksWKKIAEFFPDRSEVQCLHRWQKvlnpdlvkgpwtqeEDDKITELvskygptkwsviakslpgriGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLppvaksslqngtkdtsqstatenlvcsnkdsdsaaqtssgttdigkpdeeggkdrlepsalvpdmatsssirpneSMDSEGLECNPESPNIDLTCSESMPRLENCTVNCEFVEDKvtgtqkqvgtptyGSLYYVPPELKSFILLDKDTSNRHSVHHdynsspitspisFFTPPCVKGSGLSSPSPESILKIAAKTfpytpsifrkrkpvsqvqLDANkigkvdgesgSDRFCLSgkqesnqnnsknsrfqdaspsgsieptgmtfnasppyrlrSKRTAVFKSVERQleftsnkekgdrnanfvkpsvkgtsh
MAEVKLEEECCLENKQltaasssslsegsssailksPGVSSPATTSPTHRRTTGPIRRAKGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKSSLQNGTKDTSQSTATENLVCSNKDSDSAAQTSSGTTDIGKPDEEGGKDRLEPSALVPDMATSSSIRPNESMDSEGLECNPESPNIDLTCSESMPRLENCTVNCEFVEDKVTGTQKQVGTPTYGSLYYVPPELKSFILLDKDTSNRHSVHHDYNSSPITSPISFFTPPCVKGSGLSSPSPESILKIAAKTFPYTPSIFRKRKPVSQVQLDANKIGKVDGESGSDRFCLsgkqesnqnnsknsRFQDASPSGSIEPTGMTFNASPPYRLRSKRTAVFKSVERQLEFTSNKEKGDRNANFVKPSVKGTSH
*************************************************************************AVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATG******************************************************************************************************RLENCTVNCEFVEDKVTGTQKQVGTPTYGSLYYVPPELKSFILLDK********************ISFFTPPC*************ILKIAAKTFPYTPSIFR*************************************************************************************************************
****************************************************************PEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKK****************************************************************************************************************************************************************************************************************************************************************************************************KSVERQLEFTS*********************
********ECCLENKQL**********************************TTGPIRRAKGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKS**************TENLVC******************GKPDEEGGKDRLEPSALVPDM*********************ESPNIDLTCSESMPRLENCTVNCEFVEDKVTGTQKQVGTPTYGSLYYVPPELKSFILLDKDTSNRHSVHHDYNSSPITSPISFFTPPCV*********PESILKIAAKTFPYTPSIFRKRKPVSQVQLDANKIGKVDGESGSDRFCLSG*********************SIEPTGMTFNASPPYRLRSKRTAVFKSVERQLEFTSNKEKGDRNANFVKPSVKGTSH
***VKLEEECCLE*********************************************AKGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKK*L**Y***************************************************************************************************************************************SLYYVPPELKSFILLDKDT*********************************************************************************************NNSKNSRFQDASPSGSIEPTGMTFNASPPYRLRSKRTAVFKSVER***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEVKLEEECCLENKQLTAASSSSLSEGSSSAILKSPGVSSPATTSPTHRRTTGPIRRAKGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKSSLQNGTKDTSQSTATENLVCSNKDSDSAAQTSSGTTDIGKPDEEGGKDRLEPSALVPDMATSSSIRPNESMDSEGLECNPESPNIDLTCSESMPRLENCTVNCEFVEDKVTGTQKQVGTPTYGSLYYVPPELKSFILLDKDTSNRHSVHHDYNSSPITSPISFFTPPCVKGSGLSSPSPESILKIAAKTFPYTPSIFRKRKPVSQVQLDANKIGKVDGESGSDRFCLSGKQESNQNNSKNSRFQDASPSGSIEPTGMTFNASPPYRLRSKRTAVFKSVERQLEFTSNKEKGDRNANFVKPSVKGTSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query535 2.2.26 [Sep-21-2011]
Q9S7G7 776 Myb-related protein 3R-1 no no 0.364 0.251 0.668 5e-75
P34127 1230 Myb-like protein A OS=Dic yes no 0.278 0.121 0.684 5e-61
Q08759 624 Transcriptional activator N/A no 0.345 0.296 0.558 1e-60
P01103 641 Transcriptional activator yes no 0.336 0.280 0.573 7e-60
P10242 640 Transcriptional activator no no 0.302 0.253 0.611 1e-59
P46200 640 Transcriptional activator no no 0.302 0.253 0.611 1e-59
P06876 636 Transcriptional activator no no 0.302 0.254 0.611 1e-59
Q03237 686 Myb-related protein B OS= no no 0.433 0.338 0.463 6e-59
P48972 704 Myb-related protein B OS= no no 0.302 0.230 0.602 6e-59
P10244 700 Myb-related protein B OS= no no 0.293 0.224 0.611 2e-58
>sp|Q9S7G7|MB3R1_ARATH Myb-related protein 3R-1 OS=Arabidopsis thaliana GN=MYB3R-1 PE=2 SV=1 Back     alignment and function desciption
 Score =  282 bits (721), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 133/199 (66%), Positives = 157/199 (78%), Gaps = 4/199 (2%)

Query: 51  RTTGPIRRA-KGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPD 109
           RT+GP RR+ KG WTPEEDE L  AV  F+GK+WKKIAE F DR++VQCLHRWQKVLNP+
Sbjct: 25  RTSGPARRSTKGQWTPEEDEVLCKAVERFQGKNWKKIAECFKDRTDVQCLHRWQKVLNPE 84

Query: 110 LVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTL 169
           LVKGPW++EED+ I +LV KYGP KWS I++ LPGRIGKQCRERWHNHLNP I K+AWT 
Sbjct: 85  LVKGPWSKEEDNTIIDLVEKYGPKKWSTISQHLPGRIGKQCRERWHNHLNPGINKNAWTQ 144

Query: 170 EEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKS- 228
           EEEL L+ AH+I+GNKWAE+ K LPGR+DNSIKNHWNSS+KKKLD Y A+G L     S 
Sbjct: 145 EEELTLIRAHQIYGNKWAELMKFLPGRSDNSIKNHWNSSVKKKLDSYYASGLLDQCQSSP 204

Query: 229 --SLQNGTKDTSQSTATEN 245
             +LQN +  +S S    N
Sbjct: 205 LIALQNKSIASSSSWMHSN 223

Arabidopsis thaliana (taxid: 3702)
>sp|P34127|MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum GN=mybA PE=4 SV=2 Back     alignment and function description
>sp|Q08759|MYB_XENLA Transcriptional activator Myb OS=Xenopus laevis GN=myb PE=2 SV=1 Back     alignment and function description
>sp|P01103|MYB_CHICK Transcriptional activator Myb OS=Gallus gallus GN=MYB PE=2 SV=1 Back     alignment and function description
>sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2 Back     alignment and function description
>sp|P46200|MYB_BOVIN Transcriptional activator Myb OS=Bos taurus GN=MYB PE=2 SV=1 Back     alignment and function description
>sp|P06876|MYB_MOUSE Transcriptional activator Myb OS=Mus musculus GN=Myb PE=1 SV=2 Back     alignment and function description
>sp|Q03237|MYBB_CHICK Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1 Back     alignment and function description
>sp|P48972|MYBB_MOUSE Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1 Back     alignment and function description
>sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query535
255583121584 myb3r3, putative [Ricinus communis] gi|2 0.986 0.904 0.681 0.0
225440364558 PREDICTED: uncharacterized protein LOC10 0.973 0.933 0.685 0.0
224087417530 predicted protein [Populus trichocarpa] 0.917 0.926 0.674 0.0
31980091530 MYB transcription factor R3 type [Populu 0.945 0.954 0.661 0.0
71041080571 MYB4 [Malus x domestica] 0.979 0.917 0.625 0.0
356566509572 PREDICTED: uncharacterized protein LOC77 0.957 0.895 0.610 1e-176
356520895560 PREDICTED: uncharacterized protein LOC10 0.958 0.916 0.603 1e-173
449483381550 PREDICTED: LOW QUALITY PROTEIN: myb-rela 0.964 0.938 0.616 1e-163
449439986550 PREDICTED: myb-related protein A-like [C 0.964 0.938 0.616 1e-163
357505649566 Myb-related protein 3R-1 [Medicago trunc 0.962 0.909 0.578 1e-162
>gi|255583121|ref|XP_002532327.1| myb3r3, putative [Ricinus communis] gi|223527970|gb|EEF30054.1| myb3r3, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/558 (68%), Positives = 419/558 (75%), Gaps = 30/558 (5%)

Query: 1   MAEVKLEEECCLENKQLTAASSSSLSEGSSSAILKSPGVSSPATTSPTHRRTTGPIRRAK 60
           M E K+EE CCLENKQLTAASSSSLSEGS SA LKSPGVSSPAT SPTHRRTTGPIRRAK
Sbjct: 18  MDEAKIEE-CCLENKQLTAASSSSLSEGSGSATLKSPGVSSPATASPTHRRTTGPIRRAK 76

Query: 61  GGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEED 120
           GGWT EEDETLRNAV+ FKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEED
Sbjct: 77  GGWTLEEDETLRNAVAAFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEED 136

Query: 121 DKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHR 180
           DKITELV+KYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEE+ALMNAHR
Sbjct: 137 DKITELVAKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEEMALMNAHR 196

Query: 181 IHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKSSL---------- 230
           IHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKS +          
Sbjct: 197 IHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKSDIVFSSRKLPSV 256

Query: 231 -----QNGTKDTSQSTATENLVCSNKDSDSAAQTSSGTTDIGKPDEEGGKDRLEPSALVP 285
                Q+G KD +   +   +    K+SDS AQTSSGTTD+ K  EE  K++LE S LV 
Sbjct: 257 AKNGSQDGIKDINNKHSVFKMY---KESDSTAQTSSGTTDVCKL-EEDSKNQLESSLLVR 312

Query: 286 DMATSSSIRPNESMDSEGLECNPESPNIDLTCSESMP--RLENCTVNCEFVEDKVTGTQK 343
           D+ATSSS  PNES DSEG+EC P S   DL+C  S P  + E+C +N E  E K  G+Q 
Sbjct: 313 DLATSSSFLPNESADSEGVECKPNSFTADLSCCNSEPLRKCESCGINNEIGEGKFIGSQL 372

Query: 344 QVGTPTYGSLYYVPPELKSFILLDKDTSNRHSVHHDYNSSPITSPISFFTPPCVKGSGLS 403
             GT +YGSLYY PP+L     +  D    H V H+Y SSPI SPISFFTPPCVK S LS
Sbjct: 373 HFGTSSYGSLYYEPPQLGICTPIHVDPLIVHHVQHEYCSSPIASPISFFTPPCVKNSDLS 432

Query: 404 SPSPESILKIAAKTFPYTPSIFRKRKPVSQVQLDANKIGKVDGESGSDRFCLSGKQESNQ 463
           S SPESIL+IAAK+FP TPSIFRKRK  SQV +  +K  KV  E    R  +S  Q   +
Sbjct: 433 SQSPESILRIAAKSFPNTPSIFRKRKVGSQVHMLQSKSSKVSQEPVEGRLQVSNGQGRTE 492

Query: 464 NNSKNSRFQDASPSGS-------IEPTGMTFNASPPYRLRSKRTAVFKSVERQLEFTSNK 516
             S+ +  QD S S S       I P    FNASPPYRL+SKRTAVFKSVERQLEFT ++
Sbjct: 493 YTSEKTESQDGSLSHSPCRDNSTIRPNDKAFNASPPYRLKSKRTAVFKSVERQLEFTFDR 552

Query: 517 EKGDRNANFVKPSVKGTS 534
           ++ D +A  V  S  G+S
Sbjct: 553 DRCD-SAKSVGLSANGSS 569

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225440364|ref|XP_002270472.1| PREDICTED: uncharacterized protein LOC100256181 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224087417|ref|XP_002308158.1| predicted protein [Populus trichocarpa] gi|222854134|gb|EEE91681.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|31980091|emb|CAD98760.1| MYB transcription factor R3 type [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|71041080|gb|AAZ20428.1| MYB4 [Malus x domestica] Back     alignment and taxonomy information
>gi|356566509|ref|XP_003551473.1| PREDICTED: uncharacterized protein LOC778081 [Glycine max] Back     alignment and taxonomy information
>gi|356520895|ref|XP_003529095.1| PREDICTED: uncharacterized protein LOC100793280 [Glycine max] Back     alignment and taxonomy information
>gi|449483381|ref|XP_004156573.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439986|ref|XP_004137766.1| PREDICTED: myb-related protein A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357505649|ref|XP_003623113.1| Myb-related protein 3R-1 [Medicago truncatula] gi|355498128|gb|AES79331.1| Myb-related protein 3R-1 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query535
TAIR|locus:2180157548 MYB3R-5 "myb domain protein 3r 0.943 0.921 0.526 4.5e-130
TAIR|locus:2083599510 MYB3R-3 "myb domain protein 3r 0.555 0.582 0.626 7.1e-111
TAIR|locus:2125712 995 PC-MYB1 [Arabidopsis thaliana 0.364 0.195 0.668 3.6e-76
TAIR|locus:2144216 961 MYB3R-4 "myb domain protein 3r 0.558 0.311 0.477 1.1e-74
UNIPROTKB|Q03237 686 MYBL2 "Myb-related protein B" 0.439 0.342 0.468 3.4e-63
DICTYBASE|DDB_G0293900 1230 mybA "myb domain-containing pr 0.390 0.169 0.539 1.4e-60
UNIPROTKB|F1S3R6 761 MYB "Uncharacterized protein" 0.336 0.236 0.578 4.8e-60
UNIPROTKB|I3LQ62 675 MYB "Uncharacterized protein" 0.336 0.266 0.578 4.8e-60
UNIPROTKB|E1BZS0 654 MYBL2 "Myb-related protein B" 0.657 0.538 0.379 2e-59
MGI|MGI:97249 636 Myb "myeloblastosis oncogene" 0.336 0.283 0.572 2e-59
TAIR|locus:2180157 MYB3R-5 "myb domain protein 3r-5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1276 (454.2 bits), Expect = 4.5e-130, P = 4.5e-130
 Identities = 285/541 (52%), Positives = 345/541 (63%)

Query:     2 AEVKLEEECCLENKQXXXXXXXXXXXXXXXXXXXXPGVSSPATTSPTHRRTTGPIRRAKG 61
             +E+K+E +C +ENKQ                    P +++PAT S   RRT+GP+RRAKG
Sbjct:    18 SEMKIEIQC-MENKQPLAASCSSASEGSGCFFLKSPEIATPATVSSFPRRTSGPMRRAKG 76

Query:    62 GWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDD 121
             GWTPEEDETLR AV  +KGK WKKIAEFFP+R+EVQCLHRWQKVLNP+LVKGPWTQEEDD
Sbjct:    77 GWTPEEDETLRRAVEKYKGKRWKKIAEFFPERTEVQCLHRWQKVLNPELVKGPWTQEEDD 136

Query:   122 KITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRI 181
             KI ELV KYGP KWSVIAKSLPGRIGKQCRERWHNHLNP I+KDAWT+EEE ALMN+HR+
Sbjct:   137 KIVELVKKYGPAKWSVIAKSLPGRIGKQCRERWHNHLNPGIRKDAWTVEEESALMNSHRM 196

Query:   182 HGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKLDFYLATGKLPPVAKS-----SLQNGTKD 236
             +GNKWAEIAKVLPGRTDN+IKNHWNSSLKKKL+FYLATG LPP A        + +G +D
Sbjct:   197 YGNKWAEIAKVLPGRTDNAIKNHWNSSLKKKLEFYLATGNLPPPASKFIVLKDIADGDRD 256

Query:   237 TSQSTATENLVCSNKDSDSAAQTSSGTTDIGKPDEEGGKDRLEPS-ALVPDMATSSSIRP 295
             + QS+AT+      KDSDS  QTSSG TD      E G+D  + S AL+ ++A S  I  
Sbjct:   257 SKQSSATKPF----KDSDSLTQTSSGNTD----SNEVGRDHFDSSSALLEEVAASRRIGV 308

Query:   296 NESMDSEGLECNPESPNIDLTCSESMPRLENCTVNCEFVEDKVTGTQKQVGTPTYGSLYY 355
             NE   S  +E  P+ PN++   SE + R+ +       ++ KV   +   GTP +G+LYY
Sbjct:   309 NEYACSP-VEYKPQLPNLE-PISEEV-RINSKAYFERSIQRKV---ENGFGTPKHGNLYY 362

Query:   356 VPPELKSFILLDKDTSNRHSVHHDYNSSP-ITSPISFFTPPCVKGSGLSSP-SPESILKI 413
               P L  +   + D   +H   ++   SP   SP+S  T PC K SGL++  SPES L+ 
Sbjct:   363 KSP-LDYYFPSEADL--QHMYGYECGCSPGAASPVSLMTTPCNKDSGLTATRSPESFLRE 419

Query:   414 AAKTFPYTPSIFRKR-KPVSQVQLDANKIGKVDGESGS-DRFCLXXXXXXXXXXXXXXRF 471
             AA+TFP TPSIFRKR K V   + DA  +  V+G     DR                   
Sbjct:   420 AARTFPNTPSIFRKRRKVVLAAKTDAVVV--VNGVVKEVDR---KEESKDMRKSLLLETT 474

Query:   472 QDASPSGSIEPTGMTFNASPPYRLRSKRTAVFKSVERQLEFTSNKEKG-DRNANFVKPSV 530
              + S    +   G  FN SPPYRLR+KRTAV KS  RQLEFTS KEK  D    F     
Sbjct:   475 DNCSDDEELGLNGNAFNLSPPYRLRAKRTAVIKS--RQLEFTSEKEKQPDNEIEFTSAKE 532

Query:   531 K 531
             K
Sbjct:   533 K 533
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2083599 MYB3R-3 "myb domain protein 3r-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125712 PC-MYB1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144216 MYB3R-4 "myb domain protein 3r-4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q03237 MYBL2 "Myb-related protein B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293900 mybA "myb domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3R6 MYB "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQ62 MYB "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZS0 MYBL2 "Myb-related protein B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:97249 Myb "myeloblastosis oncogene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00021320001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (558 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
PLN03091459 PLN03091, PLN03091, hypothetical protein; Provisio 1e-24
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 6e-24
COG5147512 COG5147, REB1, Myb superfamily proteins, including 2e-23
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-18
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 9e-16
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 9e-16
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-15
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 7e-15
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-14
COG5147512 COG5147, REB1, Myb superfamily proteins, including 6e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 7e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-12
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 2e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 7e-07
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 3e-06
COG5147512 COG5147, REB1, Myb superfamily proteins, including 1e-05
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 5e-05
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 1e-04
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 0.001
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  106 bits (265), Expect = 1e-24
 Identities = 53/106 (50%), Positives = 71/106 (66%), Gaps = 3/106 (2%)

Query: 110 LVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPG--RIGKQCRERWHNHLNPDIKKDAW 167
           L KG W+ EED+K+   ++KYG   WS + K   G  R GK CR RW N+L PD+K+  +
Sbjct: 12  LRKGLWSPEEDEKLLRHITKYGHGCWSSVPK-QAGLQRCGKSCRLRWINYLRPDLKRGTF 70

Query: 168 TLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKL 213
           + +EE  ++  H + GN+W++IA  LPGRTDN IKN WNS LKKKL
Sbjct: 71  SQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKL 116

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 535
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.96
PLN03212249 Transcription repressor MYB5; Provisional 99.95
PLN03091459 hypothetical protein; Provisional 99.94
PLN03212249 Transcription repressor MYB5; Provisional 99.91
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.9
PLN03091459 hypothetical protein; Provisional 99.9
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.89
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.86
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.69
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.55
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.52
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.49
COG5147512 REB1 Myb superfamily proteins, including transcrip 99.42
COG5147512 REB1 Myb superfamily proteins, including transcrip 99.36
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.34
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.32
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.24
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.16
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.95
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.92
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.82
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.79
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.8
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.51
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.27
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.16
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.14
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.82
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.53
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.37
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.34
KOG1279506 consensus Chromatin remodeling factor subunit and 96.25
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.24
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.22
KOG1279506 consensus Chromatin remodeling factor subunit and 96.21
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.85
PRK13923170 putative spore coat protein regulator protein YlbO 95.83
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 95.62
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.51
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.2
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 94.6
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.36
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.28
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.88
KOG2656445 consensus DNA methyltransferase 1-associated prote 92.61
KOG1194534 consensus Predicted DNA-binding protein, contains 91.53
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 91.11
PRK13923170 putative spore coat protein regulator protein YlbO 90.63
KOG1194534 consensus Predicted DNA-binding protein, contains 89.74
KOG4282345 consensus Transcription factor GT-2 and related pr 88.76
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 87.76
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 87.55
KOG4282345 consensus Transcription factor GT-2 and related pr 86.37
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 86.12
KOG2656445 consensus DNA methyltransferase 1-associated prote 85.66
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 84.97
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 84.27
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 82.32
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=99.96  E-value=3.9e-30  Score=256.15  Aligned_cols=110  Identities=47%  Similarity=0.804  Sum_probs=105.3

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHhCCCchhhhccccc-ccchhhhHhhhhhhcCCCCCCCCCCHHHHHHHHHHHHHhCCch
Q 009439          108 PDLVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLP-GRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKW  186 (535)
Q Consensus       108 p~~kKg~WT~EED~~Ll~lV~kyG~~~W~~IAk~Lp-gRt~kqcr~Rw~n~L~p~ik~~~WT~EEd~~Li~lv~~~G~kW  186 (535)
                      +.+.||+||+|||++|+++|++||+.+|..|++.++ +|++++||.||.|||+|+++++.||+|||++||+||.++|++|
T Consensus         5 ~~~~kGpWt~EED~~L~~~V~~~G~~~W~~i~k~~gl~R~GKSCRlRW~NyLrP~ikrg~fT~eEe~~Ii~lH~~~GNrW   84 (238)
T KOG0048|consen    5 PELVKGPWTQEEDLTQIRSIKSFGKHNGTALPKLAGLRRCGKSCRLRWTNYLRPDLKRGNFSDEEEDLIIKLHALLGNRW   84 (238)
T ss_pred             ccccCCCCChHHHHHHHHHHHHhCCCCcchhhhhcCCCccchHHHHHhhcccCCCccCCCCCHHHHHHHHHHHHHHCcHH
Confidence            345579999999999999999999999999999999 9999999999999999999999999999999999999999999


Q ss_pred             hhHhhhCCCCCHhHHHHHHHHHHHhHHHHHh
Q 009439          187 AEIAKVLPGRTDNSIKNHWNSSLKKKLDFYL  217 (535)
Q Consensus       187 ~~IA~~lpgRT~~qcknRw~~llkkk~~~~~  217 (535)
                      +.||++|||||++.|||+|++.++|++....
T Consensus        85 s~IA~~LPGRTDNeIKN~Wnt~lkkkl~~~~  115 (238)
T KOG0048|consen   85 SLIAGRLPGRTDNEVKNHWNTHLKKKLLKMG  115 (238)
T ss_pred             HHHHhhCCCcCHHHHHHHHHHHHHHHHHHcC
Confidence            9999999999999999999999999987654

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 7e-57
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 2e-48
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 7e-43
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 3e-41
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 3e-40
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 1e-25
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 7e-20
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 2e-19
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 3e-19
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 3e-17
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 3e-17
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 9e-14
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 3e-13
1mbe_A53 Mouse C-Myb Dna-Binding Domain Repeat 1 Length = 53 4e-09
1mbe_A53 Mouse C-Myb Dna-Binding Domain Repeat 1 Length = 53 4e-07
1guu_A52 Crystal Structure Of C-Myb R1 Length = 52 4e-09
1guu_A52 Crystal Structure Of C-Myb R1 Length = 52 4e-07
2d9a_A60 Solution Structure Of Rsgi Ruh-050, A Myb Dna-Bindi 7e-07
2d9a_A60 Solution Structure Of Rsgi Ruh-050, A Myb Dna-Bindi 1e-04
2dim_A70 Solution Structure Of The Myb_dna-Binding Domain Of 3e-06
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure 
Iteration: 1

 Score =  218 bits (555), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 97/155 (62%), Positives = 123/155 (79%)
Query: 59  AKGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQE 118
            K  WT EEDE L+  V       WK IA + P+R++VQC HRWQKVLNP+L+KGPWT+E
Sbjct: 5   GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKE 64
Query: 119 EDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNA 178
           ED ++ +LV KYGP +WSVIAK L GRIGKQCRERWHNHLNP++KK +WT EE+  +  A
Sbjct: 65  EDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQA 124
Query: 179 HRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKL 213
           H+  GN+WAEIAK+LPGRTDN+IKNHWNS++++K+
Sbjct: 125 HKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 159
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1MBE|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 1 Length = 53 Back     alignment and structure
>pdb|1MBE|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 1 Length = 53 Back     alignment and structure
>pdb|1GUU|A Chain A, Crystal Structure Of C-Myb R1 Length = 52 Back     alignment and structure
>pdb|1GUU|A Chain A, Crystal Structure Of C-Myb R1 Length = 52 Back     alignment and structure
>pdb|2D9A|A Chain A, Solution Structure Of Rsgi Ruh-050, A Myb Dna-Binding Domain In Mouse Cdna Length = 60 Back     alignment and structure
>pdb|2D9A|A Chain A, Solution Structure Of Rsgi Ruh-050, A Myb Dna-Binding Domain In Mouse Cdna Length = 60 Back     alignment and structure
>pdb|2DIM|A Chain A, Solution Structure Of The Myb_dna-Binding Domain Of Human Cell Division Cycle 5-Like Protein Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query535
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 8e-99
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-40
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 2e-90
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-73
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 4e-69
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 9e-66
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 3e-65
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-36
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 9e-09
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-32
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-30
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-27
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-21
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-19
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-11
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-09
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-15
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-11
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 7e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-13
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 7e-12
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 6e-07
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-13
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-12
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 3e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 8e-13
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-11
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-12
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 7e-12
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-07
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-10
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 6e-10
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-07
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 4e-10
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 3e-07
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 6e-09
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 4e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 5e-06
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 6e-09
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 7e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 1e-08
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 1e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 7e-06
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 1e-08
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 3e-07
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 8e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 3e-08
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-07
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 4e-08
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 5e-08
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 1e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 4e-06
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 7e-08
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 3e-04
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 9e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 6e-07
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-06
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 3e-05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 8e-06
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 1e-05
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 1e-04
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 2e-04
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 4e-04
2cjj_A93 Radialis; plant development, DNA-binding protein, 2e-04
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
 Score =  294 bits (756), Expect = 8e-99
 Identities = 97/154 (62%), Positives = 123/154 (79%)

Query: 60  KGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEE 119
           K  WT EEDE L+  V       WK IA + P+R++VQC HRWQKVLNP+L+KGPWT+EE
Sbjct: 6   KTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEE 65

Query: 120 DDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAH 179
           D ++ +LV KYGP +WSVIAK L GRIGKQCRERWHNHLNP++KK +WT EE+  +  AH
Sbjct: 66  DQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAH 125

Query: 180 RIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKL 213
           +  GN+WAEIAK+LPGRTDN+IKNHWNS++++K+
Sbjct: 126 KRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 159
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query535
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.96
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.96
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.95
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.95
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.95
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.95
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.94
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.94
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.94
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.91
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.74
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.72
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.72
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.58
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.56
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.56
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.55
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.53
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.51
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.51
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.5
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.49
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.49
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.48
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.48
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.48
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.47
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.46
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.44
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.43
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.42
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.41
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.39
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.38
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.38
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.36
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.35
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.33
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.32
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.32
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.31
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.3
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.93
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.23
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.23
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.21
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.21
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.19
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.19
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.15
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.1
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.67
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.03
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.01
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.86
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.8
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.73
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.71
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.68
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.64
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.58
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.57
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.47
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.43
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.3
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.25
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.19
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.18
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.07
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.94
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.88
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.81
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.77
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.66
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.63
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.58
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.58
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.61
2crg_A70 Metastasis associated protein MTA3; transcription 97.41
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.34
2crg_A70 Metastasis associated protein MTA3; transcription 97.3
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.29
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.21
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 97.05
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.85
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.66
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.53
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.44
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.14
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 94.21
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.53
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 92.44
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 89.92
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.72
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 86.96
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=6.3e-43  Score=325.91  Aligned_cols=155  Identities=63%  Similarity=1.201  Sum_probs=113.3

Q ss_pred             CCCCCCHHHHHHHHHHHHHhcCCChhhhhhcCCCCCHHHHHHHhhhccCCCCCCCCCCHHHHHHHHHHHHHhCCCchhhh
Q 009439           59 AKGGWTPEEDETLRNAVSTFKGKSWKKIAEFFPDRSEVQCLHRWQKVLNPDLVKGPWTQEEDDKITELVSKYGPTKWSVI  138 (535)
Q Consensus        59 ~kgkWT~EEDe~L~klV~~yg~~nW~~IAk~lp~RT~~qCr~Rw~~~L~p~~kKg~WT~EED~~Ll~lV~kyG~~~W~~I  138 (535)
                      .+++||+|||++|+++|.+||..+|..||+.|++|+..||+.||.++|+|.+.+++||+|||++|+++|++||..+|..|
T Consensus         5 ~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W~~I   84 (159)
T 1h89_C            5 GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVI   84 (159)
T ss_dssp             --------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcCCCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccHHHH
Confidence            56789999999999999999988999999999999999999999999999999999999999999999999997789999


Q ss_pred             cccccccchhhhHhhhhhhcCCCCCCCCCCHHHHHHHHHHHHHhCCchhhHhhhCCCCCHhHHHHHHHHHHHhHH
Q 009439          139 AKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRIHGNKWAEIAKVLPGRTDNSIKNHWNSSLKKKL  213 (535)
Q Consensus       139 Ak~LpgRt~kqcr~Rw~n~L~p~ik~~~WT~EEd~~Li~lv~~~G~kW~~IA~~lpgRT~~qcknRw~~llkkk~  213 (535)
                      |..|++|+++||++||.++|+|.+++++||+|||.+|++++.+||++|..||++|||||+++|++||+.++++++
T Consensus        85 a~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~gRt~~~~knr~~~~~r~~~  159 (159)
T 1h89_C           85 AKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV  159 (159)
T ss_dssp             HHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTSTTCCHHHHHHHHHTTTCC--
T ss_pred             HHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHHHHhccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998763
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 535
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-24
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-17
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-22
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-17
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-11
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-22
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 5e-17
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-11
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 7e-17
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 5e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 7e-17
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-15
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 7e-11
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 9e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-11
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-15
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 5e-11
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 9e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-15
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 9e-15
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-12
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-14
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 8e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 8e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-12
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 9e-14
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-13
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-13
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-13
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-06
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 4e-11
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-08
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 3e-06
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 5e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 93.2 bits (232), Expect = 3e-24
 Identities = 39/52 (75%), Positives = 46/52 (88%)

Query: 110 LVKGPWTQEEDDKITELVSKYGPTKWSVIAKSLPGRIGKQCRERWHNHLNPD 161
           L+KGPWT+EED ++ +LV KYGP +WSVIAK L GRIGKQCRERWHNHLNP+
Sbjct: 1   LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query535
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.6
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.6
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.58
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.57
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.52
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.5
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.39
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.39
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.36
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.33
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.32
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.32
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.28
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.24
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.21
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.18
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.18
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.16
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.12
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.09
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.06
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.04
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.89
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.89
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.82
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.74
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.64
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.02
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.96
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.86
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.66
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.81
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.74
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.71
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 96.7
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.27
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.66
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.24
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.08
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 87.82
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 85.01
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 83.68
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.60  E-value=1.1e-17  Score=139.48  Aligned_cols=70  Identities=20%  Similarity=0.228  Sum_probs=64.7

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCC-----chhhhcccccccchhhhHhhhhhhcCCCCCCCCCCHHHHHHHHHHHHH
Q 009439          112 KGPWTQEEDDKITELVSKYGPT-----KWSVIAKSLPGRIGKQCRERWHNHLNPDIKKDAWTLEEELALMNAHRI  181 (535)
Q Consensus       112 Kg~WT~EED~~Ll~lV~kyG~~-----~W~~IAk~LpgRt~kqcr~Rw~n~L~p~ik~~~WT~EEd~~Li~lv~~  181 (535)
                      |+.||+|||++|+++|++||..     +|..||..||||+++||++||+++|+|.++++.||.+||.+|++++..
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~   75 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGN   75 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhc
Confidence            5789999999999999999954     399999999999999999999999999999999999999998876643
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure