Citrus Sinensis ID: 009458


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530----
MFRSINVTSRIFERQIRTPAPGTSVHCARRFYENIVPSFTVYDIECPDHSFRKFTDDGQYLISFSRNHQDLIVYRPMWLSFSCKEEDCCRHDLPPKAKRFESFFTQLYSVTLASCNELICKDFFLSMEGNQFGLFATSTAQIHDAPTTGRAIQGVPFIEKITFHLLRLEDGVVLDEKVFHNDFINLAHNMGVFLYDDLLAIVSLRYQTIHILQVRDLGNLVDVRTIGSFCREDDELFLISNSQSLATSERSRLNPFPGNQVGNGHNQVNQDDSFLSGIKQRLLSFIFQGMWNEETDQAMRVQSLKKKFFFHFQDYVDLIIWKVQFLDRHHLLIKFGSVDGGVSRNVDHHPAFFAVYNMETTEVVAFYQNSAEELYFLFEKFCDHFHATSRNSLHMNFISSHSNNVYALEQLRSIKNKGGSFSQFVKKMMASLPFGCQSQSPSPYFDQSLFRYDEKLISATDRHRQSTDHPIKFISRRPPYTLKFKIKPGPEAGTIDGRTKRISSFLFHPFLPLALSIQQTLFLQPSVVNIHFRR
cccHHHHHHHHHHcccccccccccHHHccccccccccccEEEcccccccEEEEEcccccEEEEEEccccEEEEEEcccccccccccccccccccccHHHHHHHHHHcEEEEEccccEEEEEEEEEEECccCEEEEEEcccccccccccccccccccccccEEEEEEEccccEEEEEEEEcccEEEEcccccEEEEcHHHHHHHHcEEEEEEEEEEccccEEEEEECccccccccHHHHHccccccHcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHEEEEEccccEEEEEECccccccccccccccEEEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEccccccccccccccEEEEEEEcccccEEEEEEECcccccEEEEEEECc
***SINVTSRIFERQIRTPAPGTSVHCARRFYENIVPSFTVYDIECPDHSFRKFTDDGQYLISFSRNHQDLIVYRPMWLSFSCKEEDCCRHDLPPKAKRFESFFTQLYSVTLASCNELICKDFFLSMEGNQFGLFATSTAQIHDAPTTGRAIQGVPFIEKITFHLLRLEDGVVLDEKVFHNDFINLAHNMGVFLYDDLLAIVSLRYQTIHILQVRDLGNLVDVRTIGSFCREDDELFLISNSQ******************************FLSGIKQRLLSFIFQGMWNEETDQAMRVQSLKKKFFFHFQDYVDLIIWKVQFLDRHHLLIKFGSVDGGVSRNVDHHPAFFAVYNMETTEVVAFYQNSAEELYFLFEKFCDHFHATSRNSLHMNFISSHSNNVYALEQLRSIKNKGGSFSQFVKKMMASLPFGCQSQSPSPYFDQSLFRYDEKLISATDRHRQSTDHPIKFISRRPPYTLKFKIKPGPEAGTIDGRTKRISSFLFHPFLPLALSIQQTLFLQPSVVNIHFRR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRSINVTSRIFERQIRTPAPGTSVHCARRFYENIVPSFTVYDIECPDHSFRKFTDDGQYLISFSRNHQDLIVYRPMWLSFSCKEEDCCRHDLPPKAKRFESFFTQLYSVTLASCNELICKDFFLSMEGNQFGLFATSTAQIHDAPTTGRAIQGVPFIEKITFHLLRLEDGVVLDEKVFHNDFINLAHNMGVFLYDDLLAIVSLRYQTIHILQVRDLGNLVDVRTIGSFCREDDELFLISNSQSLATSERSRLNPFPGNQVGNGHNQVNQDDSFLSGIKQRLLSFIFQGMWNEETDQAMRVQSLKKKFFFHFQDYVDLIIWKVQFLDRHHLLIKFGSVDGGVSRNVDHHPAFFAVYNMETTEVVAFYQNSAEELYFLFEKFCDHFHATSRNSLHMNFISSHSNNVYALEQLRSIKNKGGSFSQFVKKMMASLPFGCQSQSPSPYFDQSLFRYDEKLISATDRHRQSTDHPIKFISRRPPYTLKFKIKPGPEAGTIDGRTKRISSFLFHPFLPLALSIQQTLFLQPSVVNIHFRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Light-mediated development protein DET1 Component of light signal transduction machinery. Involved in repression of photomorphogenesis in darkness by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes (E2s). Involved in repression of deetiolation in the developing seedling. Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5, HYH and LAF1. Involved in the repression of blue light responsive promoter in chloroplasts. May be required to stabilize the CDD complex. Its association with histone tail suggests a role in remodeling of chromatin.confidentP48732
Light-mediated development protein DET1 Component of light signal transduction machinery. Involved in fruit pigmentation and fruit nutritional quality. Acts as a negative regulator of fruit pigmentation. Probably acts by participating in the CDD complex, a complex probably required to regulate the activity of ubiquitin conjugating enzymes. Repression of photomorphogenesis is probably mediated by ubiquitination and subsequent degradation of photomorphogenesis-promoting factors such as HY5.probableQ9ZNU6
DET1 homolog Component of the E3 ubiquitin ligase DCX DET1-COP1 complex, which is required for ubiquitination and subsequent degradation of target proteins. The complex is involved in JUN ubiquitination and degradation.probableQ7L5Y6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RI6, chain A
Confidence level:confident
Coverage over the Query: 52-87,104-139,160-224
View the alignment between query and template
View the model in PyMOL
Template: 3SCY, chain A
Confidence level:probable
Coverage over the Query: 52-139,160-226
View the alignment between query and template
View the model in PyMOL
Template: 2GOP, chain A
Confidence level:probable
Coverage over the Query: 124-173
View the alignment between query and template
View the model in PyMOL