Citrus Sinensis ID: 009461


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530----
MSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAILAARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAGERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFKDEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGLTTLAAMEKVPVDENDRPLEEIKITGVTVFVNPYSEPDEEEEEEKAKDEKNAEDEDKDKVGSWYSNPGTGTQAGAVGGGGVGKYLKARSAPIDSAADDGGLTAIATAKKRKVGVSAGEFKDFSGW
cccHHHHHHccccccccccccccccEEEEccccccccccccccccccccccEEEEEEcccEEEHHHHHHHHHHHccccccccccccccccccEEccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHHccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHcccccHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHHccccccccEEEcccccEEEcccccccccccccccccccccccccccccccccEEEccccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHccccccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKV*************YNINVAGDIKQMLQELGTEK****************ERAAALAAI*****************************************************************VNAKLVKS*YT*******FTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFKDEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGLTTLAAMEKVPVDENDRPLEEIKITGVTVFVNPYSE**********************************************************************************FKDFSGW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAILAARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAGERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFKDEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGLTTLAAMEKVPVDENDRPLEEIKITGVTVFVNPYSEPDEEEEEEKAKDEKNAEDEDKDKVGSWYSNPGTGTQAGAVGGGGVGKYLKARSAPIDSAADDGGLTAIATAKKRKVGVSAGEFKDFSGW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase-like 2 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.confidentQ9FJX0
Peptidyl-prolyl cis-trans isomerase-like 2 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableP0CP90
Peptidyl-prolyl cis-trans isomerase-like 2 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableQ13356

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZKC, chain A
Confidence level:very confident
Coverage over the Query: 280-453
View the alignment between query and template
View the model in PyMOL
Template: 2BAY, chain A
Confidence level:confident
Coverage over the Query: 38-96
View the alignment between query and template
View the model in PyMOL
Template: 2BAY, chain A
Confidence level:confident
Coverage over the Query: 2-31
View the alignment between query and template
View the model in PyMOL