Citrus Sinensis ID: 009507


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530---
MMFWHQEAELALIPVQFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNNNKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWLNNYHSQVWEKVSPLLDGFARQWLWNNTRPVAKD
ccccccccEEEEccccccccHHHHHHHHHHHHHcccEEEEcccccHHHHHcccccccccccccEEcccccccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHccccccccccccEEEEEEEEcccEEEEEccccccHHHHHHHHHcccEECccHHHHHHHHHHHHcccCEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccECccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEccccccccccccEEEEccEEEEEEccccccccccccCCccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccc
**FWHQEAELALIPVQFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNNNKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWLNNYHSQVWEKVSPLLDGFARQWLWNNTRP****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMFWHQEAELALIPVQFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNNNKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWLNNYHSQVWEKVSPLLDGFARQWLWNNTRPVAKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable Xaa-Pro aminopeptidase P Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides.probableA2QGR5
Probable Xaa-Pro aminopeptidase P Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides.probableB6HQC9
Uncharacterized peptidase C22G7.01c probableQ09795

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CTZ, chain A
Confidence level:very confident
Coverage over the Query: 6-192,220-530
View the alignment between query and template
View the model in PyMOL