Citrus Sinensis ID: 009586


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-
MLNIWKYDSSVLKAFSPVYIYRYFRRGGRDGWTSLGGIMLSITGTEALFADLAHFPVSAIQIAFTVVVFPCLLLAYSGQAAYLMNHQDHVVDAFYRSIPDSIYWPVFIVATAAAIVASQATISATFSIIKQALALGCFPRVKVVHTSKKFLGQIYIPDINWILMILCIAVTAGFKNQSQIGNAYGTAVVIVMLATTLLMTLIMILVWRCHWILVLIFTALSLVVECTYFSAVLFKVDQGGWVPLVIAAAFLVIMYVWHYGTVKRYEFEMHSKVSMAWILGLGPSLGLVRVPGIGLVYTELASGVPHIFSHFITNLPAIHSVVVFVCVKYLPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKKLFDSLFLFVRLEAMMEGCSDSDEYSLYGQQTLQSTDGLLNNNGNSTSSNQDLTMSSVDSIVPVKSPLHVNSTVMSSSQMSSHTETDELEFLNSCRDAGVVHILGNTVVRASRGSKFYKKIAIDYIYAFLRKICRENSVIFNVPHESLLNVGQIFYV
cEEEEEEcccccEEccHHHHHHHHHHccccCEEECccHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccEECcHHHHHHHHHHHHHEEECccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccccccEEEEccccccccHHHHHHHHccccccEEEEEEEEEECccccccccccEEEEECccccccEEEEEEEECccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEEc
MLNIWKYDSSVLKAFSPVYIYRYFRRGGRDGWTSLGGIMLSITGTEALFADLAHFPVSAIQIAFTVVVFPCLLLAYSGQAAYLMNHQDHVVDAFYRSIPDSIYWPVFIVATAAAIVASQATISATFSIIKQALALGCFPRVKVVHTSKKFLGQIYIPDINWILMILCIAVTAGFKNQSQIGNAYGTAVVIVMLATTLLMTLIMILVWRCHWILVLIFTALSLVVECTYFSAVLFKVDQGGWVPLVIAAAFLVIMYVWHYGTVKRYEFEMHSKVSMAWILGLGPSLGLVRVPGIGLVYTELASGVPHIFSHFITNLPAIHSVVVFVCVKYLPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKKLFDSLFLFVRLEAMME***********************************************************************LEFLNSCRDAGVVHILGNTVVRASRGSKFYKKIAIDYIYAFLRKICRENSVIFNVPHESLLNVGQIFYV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNIWKYDSSVLKAFSPVYIYRYFRRGGRDGWTSLGGIMLSITGTEALFADLAHFPVSAIQIAFTVVVFPCLLLAYSGQAAYLMNHQDHVVDAFYRSIPDSIYWPVFIVATAAAIVASQATISATFSIIKQALALGCFPRVKVVHTSKKFLGQIYIPDINWILMILCIAVTAGFKNQSQIGNAYGTAVVIVMLATTLLMTLIMILVWRCHWILVLIFTALSLVVECTYFSAVLFKVDQGGWVPLVIAAAFLVIMYVWHYGTVKRYEFEMHSKVSMAWILGLGPSLGLVRVPGIGLVYTELASGVPHIFSHFITNLPAIHSVVVFVCVKYLPVYTVPEEERFLVKRIGPKNFHMFRCVARYGYKDLHKKDENFEKKLFDSLFLFVRLEAMMEGCSDSDEYSLYGQQTLQSTDGLLNNNGNSTSSNQDLTMSSVDSIVPVKSPLHVNSTVMSSSQMSSHTETDELEFLNSCRDAGVVHILGNTVVRASRGSKFYKKIAIDYIYAFLRKICRENSVIFNVPHESLLNVGQIFYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative potassium transporter 12 High-affinity potassium transporter.probableQ8VXB1
Probable potassium transporter 11 High-affinity potassium transporter.probableQ7XLC6
Potassium transporter 11 Probable potassium transporter.probableO64769

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GIA, chain A
Confidence level:probable
Coverage over the Query: 127-195
View the alignment between query and template
View the model in PyMOL
Template: 4DJK, chain A
Confidence level:probable
Coverage over the Query: 30-63
View the alignment between query and template
View the model in PyMOL