Citrus Sinensis ID: 009604

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-

MAVSSCSSQKILSFSSSCSSFECRSDPDFSGSARFDKPRISAARVIGASTASFSGVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNSVGSGSNSAAATAASAAPAPPAPVEITSGDDIALVDGLKNVQLEALADLKNEASFLSSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccHHHHHHHHHHHcccccHHHHHHHHcccccccccccccHHHHHHccccccccccccccccHHHccccHHHHHHHHHHHcccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHccccccEEcccccccHHHHHHHHHHHHcHHHHHHHHHHccccccEEEEcccccccHHHHHHHHccccccEEEEEccccHHHHHHHccccccCEEEEEcccccccccccHHHHHHHHHccccEEEEccccccccccccccccccEEEEcccccccccccccccEEEcccHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHccccccEEEEEEcccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHc

******************************************************GVSSLIFRFPPNFVRQLSTKARRNCSNIGVAQIVAASW**********************************************************SSDGSLAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRRASFEYGRYGNPTTVGAESTVIMASGMSASTVMLLALVPAGGHIVTTTDCYRKTRIFIETVLPKMGITATVIDPADMEGLEAALNNNNVSLFFTESPTNPFLRCVDVKLVSDLCHKKGAIVCIDGTFATPLNQKALSLGADLVLHSATKFIGGHNDVLAGSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cystathionine gamma-synthase, chloroplastic	Catalyzes the formation of L-cystathionine from O-succinyl-L-homoserine (OSHS) and L-cysteine, via a gamma-replacement reaction. In the absence of thiol, catalyzes gamma-elimination to form 2-oxobutanoate, succinate and ammonia.	probable	P55217

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.5.-.-	Transferring alkyl or aryl groups, other than methyl groups.	probable
2.5.1.-	5,10-methenyltetrahydromethanopterin hydrogenase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QGN, chain A
Confidence level:very confident
Coverage over the Query: 145-531
View the alignment between query and template
View the model in PyMOL