BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 009677
         (529 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HG6|A Chain A, Structure Of A Cellulose Synthase - Cellulose
           Translocation Intermediate
          Length = 802

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 12/131 (9%)

Query: 219 SCSYEHQTKWGEEVGILYQSVSEDLFTGFILHCKGWTSTYLTPFRPQFLGTSTTNLNDLL 278
           S +   +    E  G   ++++ED  T   +H +GW S Y+   R    G         +
Sbjct: 320 SAAVLRRRALDEAGGFAGETITEDAETALEIHSRGWKSLYID--RAMIAGLQPETFASFI 377

Query: 279 IQGTRWGSGLTDVGLSRFCPLLYGPSRMSLLQSMCY-GELS--FFPLLYCLPLWCLATLP 335
            Q  RW +G+  + L +      G   + + Q +CY   +S  FFPL+  + L      P
Sbjct: 378 QQRGRWATGMMQMLLLKNPLFRRG---LGIAQRLCYLNSMSFWFFPLVRMMFL----VAP 430

Query: 336 QLCLLNGISLY 346
            + L  GI ++
Sbjct: 431 LIYLFFGIEIF 441


>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform
           Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With
           Nad, From Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic
           A4 Glyceraldehyde 3-Phosphate Dehydrogenase (Gapdh) With
           Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By
           Soaking, Of Photosyntetic A4 Glyceraldehyde 3-Phosphate
           Dehydrogenase (Gapdh) With Cp12-2, Both From Arabidopsis
           Thaliana
          Length = 337

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 42  DLVEMPLLVYVSREKRPEHLHHFKAGALNVLLRVSGVISNSPYILGLDCDMYCNDPTSAR 101
           D+V     V+V RE   +H+   +AGA  V++   G      Y++G++ D Y +D     
Sbjct: 94  DIVIEGTGVFVDREGAGKHI---EAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIIS 150

Query: 102 QAMC 105
            A C
Sbjct: 151 NASC 154


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.139    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,272,804
Number of Sequences: 62578
Number of extensions: 619480
Number of successful extensions: 1441
Number of sequences better than 100.0: 29
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 28
Number of HSP's that attempted gapping in prelim test: 1440
Number of HSP's gapped (non-prelim): 29
length of query: 529
length of database: 14,973,337
effective HSP length: 103
effective length of query: 426
effective length of database: 8,527,803
effective search space: 3632844078
effective search space used: 3632844078
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 54 (25.4 bits)