Query         009724
Match_columns 527
No_of_seqs    170 out of 1167
Neff          7.1 
Searched_HMMs 29240
Date          Mon Mar 25 11:36:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/009724.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/009724hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3iyz_A Aquaporin-4; water tran  22.3 5.3E+02   0.018   25.7  10.7   19  313-331   171-189 (340)
  2 3llq_A Aquaporin Z 2; aquapori  15.7 6.7E+02   0.023   23.7   9.5   20  313-332   155-174 (256)
  3 4g1u_A Hemin transport system   10.9 1.1E+03   0.039   23.3  13.3   32  380-412   292-323 (357)
  4 2l2t_A Receptor tyrosine-prote  10.8 1.5E+02  0.0051   20.5   2.2   16  447-462    25-40  (44)
  5 2ks1_B Epidermal growth factor  10.2 1.6E+02  0.0055   20.3   2.2   16  447-462    26-41  (44)
  6 2jwa_A Receptor tyrosine-prote  10.1 1.6E+02  0.0054   20.4   2.2   19  444-462    23-41  (44)
  7 2l8s_A Integrin alpha-1; trans   9.9 4.8E+02   0.016   18.8   4.7   37   68-105     2-38  (54)
  8 2k1a_A Integrin alpha-IIB; sin   8.6 2.3E+02  0.0078   19.4   2.5   17  201-217     5-21  (42)
  9 3h3g_B Parathyroid hormone-rel   8.1 1.5E+02  0.0053   17.8   1.2   17  302-327     4-20  (24)
 10 2v2f_A Penicillin binding prot   7.5 1.5E+02   0.005   17.6   1.0   12  111-122     5-16  (26)

No 1  
>3iyz_A Aquaporin-4; water transport, water channel, two-dimensional C membrane protein, baculovirus expression system, glycoprote membrane; 10.00A {Rattus norvegicus}
Probab=22.33  E-value=5.3e+02  Score=25.69  Aligned_cols=19  Identities=11%  Similarity=-0.046  Sum_probs=13.1

Q ss_pred             CChhhHHHHHhhhhhhhHH
Q 009724          313 IPPRCMYTAQLVGTIVSGV  331 (527)
Q Consensus       313 ~pPR~~f~~Q~iGtivg~~  331 (527)
                      .++-..|..|+++|++=.+
T Consensus       171 ~s~~~~f~~E~i~Tf~Lv~  189 (340)
T 3iyz_A          171 LTAGHGLLVELIITFQLVF  189 (340)
T ss_pred             cCHHHHHHHHHHHHHHHHH
Confidence            3555678888888876443


No 2  
>3llq_A Aquaporin Z 2; aquaporin tetramer, membrane protein, water channel, structu genomics, PSI-2, protein structure initiative; 2.01A {Agrobacterium tumefaciens str}
Probab=15.67  E-value=6.7e+02  Score=23.73  Aligned_cols=20  Identities=10%  Similarity=-0.047  Sum_probs=14.4

Q ss_pred             CChhhHHHHHhhhhhhhHHH
Q 009724          313 IPPRCMYTAQLVGTIVSGVV  332 (527)
Q Consensus       313 ~pPR~~f~~Q~iGtivg~~v  332 (527)
                      .++...|..|+++|++=.++
T Consensus       155 ~s~~~~f~~E~i~Tf~Lv~~  174 (256)
T 3llq_A          155 YSLVSALLIEIILTAFFLIV  174 (256)
T ss_dssp             CCHHHHHHHHHHHHHHHHHH
T ss_pred             cCHHHHHHHHHHHHHHHHHH
Confidence            34567899999999875443


No 3  
>4g1u_A Hemin transport system permease protein HMUU; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}
Probab=10.88  E-value=1.1e+03  Score=23.28  Aligned_cols=32  Identities=25%  Similarity=0.125  Sum_probs=21.3

Q ss_pred             ccccCCCCchhHHHHHHHHHHHHHHHHHHHHhh
Q 009724          380 RRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKV  412 (527)
Q Consensus       380 ~~~f~~g~~y~~l~~~~liG~~~~i~~~l~~r~  412 (527)
                      +++++++ .-..++.+.++|+++-+.--.+.|.
T Consensus       292 R~l~g~~-~~~llp~Sal~Ga~lll~aD~lar~  323 (357)
T 4g1u_A          292 RMRIGAD-HRWLLPGAALGGACLLLTADTLART  323 (357)
T ss_dssp             HTTSCSC-HHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHhCCC-cchHHHHHHHHHHHHHHHHHHHHHH
Confidence            4455542 2346778999999888877777654


No 4  
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens}
Probab=10.79  E-value=1.5e+02  Score=20.54  Aligned_cols=16  Identities=31%  Similarity=0.557  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHhcCcc
Q 009724          447 ITGMIFNYFVFRYHKR  462 (527)
Q Consensus       447 ~vG~~~~~~~rr~~~~  462 (527)
                      +++....+|+|||+.+
T Consensus        25 ii~~~~~~~~RRRr~~   40 (44)
T 2l2t_A           25 IVGLTFAVYVRRKSIK   40 (44)
T ss_dssp             HHHHHHHHHHHTTCSS
T ss_pred             HHHHHHHHHhhhhhhh
Confidence            4455667788887654


No 5  
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens}
Probab=10.18  E-value=1.6e+02  Score=20.33  Aligned_cols=16  Identities=19%  Similarity=0.283  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHhcCcc
Q 009724          447 ITGMIFNYFVFRYHKR  462 (527)
Q Consensus       447 ~vG~~~~~~~rr~~~~  462 (527)
                      +++....+|+|||+.+
T Consensus        26 ii~~~~~~~~RRr~~~   41 (44)
T 2ks1_B           26 VVALGIGLFMRRRHIV   41 (44)
T ss_dssp             HHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHHhhhhHhh
Confidence            4445566788887654


No 6  
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A
Probab=10.12  E-value=1.6e+02  Score=20.43  Aligned_cols=19  Identities=16%  Similarity=0.474  Sum_probs=13.7

Q ss_pred             hHHHHHHHHHHHHHhcCcc
Q 009724          444 SWLITGMIFNYFVFRYHKR  462 (527)
Q Consensus       444 ~~~~vG~~~~~~~rr~~~~  462 (527)
                      ..+++++.+..|+|||+-+
T Consensus        23 l~vi~~l~~~~~~RRR~~~   41 (44)
T 2jwa_A           23 LVVVLGVVFGILIKRRQQK   41 (44)
T ss_dssp             HHHHHHHHHHHHHHHHCSC
T ss_pred             HHHHHHHHHHhheehhhhh
Confidence            4566777778889888754


No 7  
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens}
Probab=9.85  E-value=4.8e+02  Score=18.81  Aligned_cols=37  Identities=16%  Similarity=0.256  Sum_probs=21.5

Q ss_pred             CCcccccHHHHHHHHHHHHHHHHHHHHHHhhccCCCcC
Q 009724           68 GSPLVTPWTSILNVGIGFVMFIYIIVPLCYWKFDTFDA  105 (527)
Q Consensus        68 g~pl~~P~~~~~n~~~G~vl~~~ii~P~ly~~~n~w~~  105 (527)
                      |.|--+|+|..+-..+|.++-..+++-++|- -+.+.-
T Consensus         2 ~~~~~vp~WiIi~svl~GLLLL~Lii~~LwK-~GFFKR   38 (54)
T 2l8s_A            2 GLPGRVPLWVILLSAFAGLLLLMLLILALWK-IGFFKR   38 (54)
T ss_dssp             CCCCCCCTHHHHHHHHHHHHHHHHHHHHHHH-HHHTTS
T ss_pred             CCCccCchHHHHHHHHHHHHHHHHHHHHHHH-cCcccC
Confidence            5566789888665555555544444435554 465543


No 8  
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A
Probab=8.59  E-value=2.3e+02  Score=19.37  Aligned_cols=17  Identities=35%  Similarity=1.013  Sum_probs=10.0

Q ss_pred             cCCCCchHHHHHHHHHH
Q 009724          201 YKQVPQWWFYVLLLGSI  217 (527)
Q Consensus       201 y~~vP~ww~~~~~v~s~  217 (527)
                      +.++|.|.+....+..+
T Consensus         5 ~~~vp~wiIi~s~l~GL   21 (42)
T 2k1a_A            5 ERAIPIWWVLVGVLGGL   21 (42)
T ss_dssp             CCCCCHHHHHHHHHHHH
T ss_pred             cCCcchHHHHHHHHHHH
Confidence            35678776655554443


No 9  
>3h3g_B Parathyroid hormone-related protein; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli}
Probab=8.07  E-value=1.5e+02  Score=17.76  Aligned_cols=17  Identities=29%  Similarity=0.671  Sum_probs=12.8

Q ss_pred             hhccchhhhcCCChhhHHHHHhhhhh
Q 009724          302 LSDLKLGHYMKIPPRCMYTAQLVGTI  327 (527)
Q Consensus       302 ~~DlK~G~y~~~pPR~~f~~Q~iGti  327 (527)
                      +||+|         |.+|.-++++.+
T Consensus         4 ~Q~~r---------Rr~wL~~ll~~v   20 (24)
T 3h3g_B            4 IQDLR---------RRFFLHHLIAEI   20 (26)
T ss_dssp             HHHHH---------HHHHHHHHHHHH
T ss_pred             HHHHH---------HHHHHHHHHHHh
Confidence            68888         888887777643


No 10 
>2v2f_A Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc5_A* 2zc6_A*
Probab=7.46  E-value=1.5e+02  Score=17.56  Aligned_cols=12  Identities=8%  Similarity=0.301  Sum_probs=9.3

Q ss_pred             CcccccccCCce
Q 009724          111 FSNQLFTSSGHK  122 (527)
Q Consensus       111 ~s~~~fd~~g~~  122 (527)
                      .++.+||++|+.
T Consensus         5 ~ss~IYD~~g~~   16 (26)
T 2v2f_A            5 TSSKIYDNKNQL   16 (26)
T ss_pred             CCCEEEeCCCCE
Confidence            467889998875


Done!