Citrus Sinensis ID: 009737


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------
MAADSKTSLSNGNVSTQPNPKRSYQVVVAATRDMGIGKDGKLPWKLPSDLKFFKEITQITSDAGKRNAVIMGRKTWESIPLEHRPLPGRLNVVLTRSGSFDIATVENVVICGSIGSALELLAASPYCLSIEKVFVIGGGQILSEALNAPECDAIHITEIETRIECDTFIPSIDSSVFQPWYSSFPIVENNIRYCLSTYVRVRSAAVESLSQNNDIVLDSKTNSDKFEVKQFSFLPKMVFEKHEEYLYLRLVQDIISDGNLKDDRTGTGTLSKFGCQMRYNLRTTFPLLTTKALFWRGVVEELLWFISGSTNAKVLQEKDIHIWDGNASREYLDSVGLTDREEGDLGPVYGFQWRHFGARYTNMHADYSGQGFDQLLDVINKIKNNPNDRRIVLSAWNPSDLKLMALPPCHMFAQFYMANGELSCQMYQRSADMGLGVPFNIASYALLTCMIAHVCDLAPGDFIHVIGDAHVYRNHVRPLEEQLQKLPKPFPILKINPEKKDIDSFVAEDFKLIGYDPHQKIEMKMAV
cccccccccccccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHccccccccccccEEEEccccccccccccccccccEEEEEcccccccccccccEEEEccHHHHHHHHHcccccccccEEEEEccHHHHHHHHccccccEEEEEEEccccccccccccccccccEEcccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccCECccccHHHHHHHHHHHHcccccHHHHHccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccCEEEcccccccccccccccEEEEEEEEEccEEEEEEHHcccccccccccHHHHHHHHHHHHHHHcccccccEEEEccccHHccccHHHHHHHHcccccccccEEEccccccccccccccEEEEcccccccccccccc
**********************SYQVVVAATRDMGIGKDGKLPWKLPSDLKFFKEITQITSDAGKRNAVIMGRKTWESIPLEHRPLPGRLNVVLTRSGSFDIATVENVVICGSIGSALELLAASPYCLSIEKVFVIGGGQILSEALNAPECDAIHITEIETRIECDTFIPSIDSSVFQPWYSSFPIVENNIRYCLSTYVRVRS*********************KFEVKQFSFLPKMVFEKHEEYLYLRLVQDIISDGNLKDDRTGTGTLSKFGCQMRYNLRTTFPLLTTKALFWRGVVEELLWFISGSTNAKVLQEKDIHIWDGNASREYLDSVGLTDREEGDLGPVYGFQWRHFGARYTNMHADYSGQGFDQLLDVINKIKNNPNDRRIVLSAWNPSDLKLMALPPCHMFAQFYMANGELSCQMYQRSADMGLGVPFNIASYALLTCMIAHVCDLAPGDFIHVIGDAHVYRNHVRPLEEQLQKLPKPFPILKINPEKKDIDSFVAEDFKLIGYDPHQKIEMKMAV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAADSKTSLSNGNVSTQPNPKRSYQVVVAATRDMGIGKDGKLPWKLPSDLKFFKEITQITSDAGKRNAVIMGRKTWESIPLEHRPLPGRLNVVLTRSGSFDIATVENVVICGSIGSALELLAASPYCLSIEKVFVIGGGQILSEALNAPECDAIHITEIETRIECDTFIPSIDSSVFQPWYSSFPIVENNIRYCLSTYVRVRSAAVESLSQNNDIVLDSKTNSDKFEVKQFSFLPKMVFEKHEEYLYLRLVQDIISDGNLKDDRTGTGTLSKFGCQMRYNLRTTFPLLTTKALFWRGVVEELLWFISGSTNAKVLQEKDIHIWDGNASREYLDSVGLTDREEGDLGPVYGFQWRHFGARYTNMHADYSGQGFDQLLDVINKIKNNPNDRRIVLSAWNPSDLKLMALPPCHMFAQFYMANGELSCQMYQRSADMGLGVPFNIASYALLTCMIAHVCDLAPGDFIHVIGDAHVYRNHVRPLEEQLQKLPKPFPILKINPEKKDIDSFVAEDFKLIGYDPHQKIEMKMAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional dihydrofolate reductase-thymidylate synthase 1 Bifunctional enzyme. Involved in de novo dTMP biosynthesis. Key enzyme in folate metabolism. Can play two different roles depending on the source of dihydrofolate: de novo synthesis of tetrahydrofolate or recycling of the dihydrofolate released as one of the end products of the TS catalyzed reaction. Catalyzes an essential reaction for de novo glycine and purine synthesis, DNA precursor synthesis, and for the conversion of dUMP to dTMP.confidentQ05762
Bifunctional dihydrofolate reductase-thymidylate synthase Bifunctional enzyme. Involved in de novo dTMP biosynthesis. Key enzyme in folate metabolism. Can play two different roles depending on the source of dihydrofolate: de novo synthesis of tetrahydrofolate or recycling of the dihydrofolate released as one of the end products of the TS catalyzed reaction. Catalyzes an essential reaction for de novo glycine and purine synthesis, DNA precursor synthesis, and for the conversion of dUMP to dTMP.probableP45350
Bifunctional dihydrofolate reductase-thymidylate synthase Bifunctional enzyme. Involved in de novo dTMP biosynthesis. Key enzyme in folate metabolism. Can play two different roles depending on the source of dihydrofolate: de novo synthesis of tetrahydrofolate or recycling of the dihydrofolate released as one of the end products of the TS catalyzed reaction. Catalyzes an essential reaction for de novo glycine and purine synthesis, DNA precursor synthesis, and for the conversion of dUMP to dTMP.probableO81395

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
2.-.-.-Transferases.probable
1.5.-.-Acting on the CH-NH group of donors.probable
2.1.-.-Transferring one-carbon groups.probable
1.5.1.-5,10-methylenetetrahydromethanopterin reductase.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
1.5.1.3Transferred entry: 1.5.1.33.probable
2.1.1.45Thymidylate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HW4, chain A
Confidence level:very confident
Coverage over the Query: 240-320,343-524
View the alignment between query and template
View the model in PyMOL
Template: 3NRR, chain A
Confidence level:very confident
Coverage over the Query: 16-527
View the alignment between query and template
View the model in PyMOL