Citrus Sinensis ID: 009802


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----
MLTFMVGQKQAFEVSLADVSQTQLQGKNDVILEFHVDDTTGANEKDSLMEISFHIPNSNTQFVGDENHPPAQVFRDKIMSMADVGAGGEEAVVTFEGIAILTPRGRYSVELHLSFLRLQGQANDFKIQYSSVVRLFLLPKSNQPHTFVVVTLDPPIRKGQTLYPHIVLQFETDYVVQSELLMSEELLNTKYKDKLEPSYKGLIHEVFTTILRGLSGAKITKPGKFRSAQDGYAVKSSLKAEDGVLYPLEKSFFFLPKPPTLILHEEIDYVEFERHAAGGSNMHYFDLLIRLKTEQEHLFRNIQRNEYHNLFDFISGKGLKIMNLGDMKTTDGVAAVLQEDDDDAVDPHLERIKNEAGGDESDEEDSDFVADKDDGGSPTDDSGEEDSDASESGGEKEKPAKKESKKESSSVKASTSKKKSRDGDEDGKKKKQKKKKDPNAPKRAMSGFIFFSQMERENIKKSNPGIAFTDVGRVLGERWKKMSVEEREPYESKARADKKRYKDEISGYKNPKPMDIDSGNESDSA
cEEEEEccEEEEEEEHHHHHccccccccEEEEEEEccccccccccccEEEEEEEEccccccccccccccHHHHHHHHHHHHcccccccccEEEEEcccEEcccccCEEEEEEcccEEEEcccccEEEEcccEEEEEEECccccccEEEEEECccccccccccccEEEEEEEcccEEEEEccccHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccECccccccEEEEccccccCEECccccEEEECcccEEEEcccEEEEEEEEEccccccCEEEEEEEEEccccEEEEEcccHHHHHHHHHHHcccccEEEcccccccccHHHHHccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
MLTFM**QKQAFEVSLADVSQTQLQGKNDVILEFHVDDTTGANEKDSLMEISFHIPN***************VFRDKIMSMADVGAGGEEAVVTFEGIAILTPRGRYSVELHLSFLRLQGQANDFKIQYSSVVRLFLLPKSNQPHTFVVVTLDPPIRKGQTLYPHIVLQFETDYVVQSELLMSEELLNTKYKDKLEPSYKGLIHEVFTTILRGLSGAKITKPGKFRSAQDGYAVKSSLKAEDGVLYPLEKSFFFLPKPPTLILHEEIDYVEFERHAAGGSNMHYFDLLIRLKTEQEHLFRNIQRNEYHNLFDFISGKGLKIMNLGDMKTTDGVAAV**************************************************************************************************************GFIFFSQMERENIKKSNPGIAFTDVGRVLGERWK********PYESKARADKKRYKDEI********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTFMVGQKQAFEVSLADVSQTQLQGKNDVILEFHVDDTTGANEKDSLMEISFHIPNSNTQFVGDENHPPAQVFRDKIMSMADVGAGGEEAVVTFEGIAILTPRGRYSVELHLSFLRLQGQANDFKIQYSSVVRLFLLPKSNQPHTFVVVTLDPPIRKGQTLYPHIVLQFETDYVVQSELLMSEELLNTKYKDKLEPSYKGLIHEVFTTILRGLSGAKITKPGKFRSAQDGYAVKSSLKAEDGVLYPLEKSFFFLPKPPTLILHEEIDYVEFERHAAGGSNMHYFDLLIRLKTEQEHLFRNIQRNEYHNLFDFISGKGLKIMNLGDMKTTDGVAAVLQEDDDDAVDPHLERIKNEAGGDESDEEDSDFVADKDDGGSPTDDSGEEDSDASESGGEKEKPAKKESKKESSSVKASTSKKKSRDGDEDGKKKKQKKKKDPNAPKRAMSGFIFFSQMERENIKKSNPGIAFTDVGRVLGERWKKMSVEEREPYESKARADKKRYKDEISGYKNPKPMDIDSGNESDSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
FACT complex subunit SSRP1 Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. Binds specifically to double-stranded DNA.confidentQ05153
FACT complex subunit SSRP1-A Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. Binds specifically to double-stranded DNA.confidentQ9LGR0
FACT complex subunit SSRP1 Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. Binds specifically to double-stranded DNA.probableQ39601

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GCL, chain A
Confidence level:very confident
Coverage over the Query: 87-323
View the alignment between query and template
View the model in PyMOL
Template: 2YRQ, chain A
Confidence level:very confident
Coverage over the Query: 430-513
View the alignment between query and template
View the model in PyMOL