Query         009820
Match_columns 524
No_of_seqs    135 out of 183
Neff          4.3 
Searched_HMMs 46136
Date          Thu Mar 28 17:43:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/009820.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/009820hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11955 PORR:  Plant organelle 100.0  3E-113  6E-118  878.5  31.2  332   85-421     1-334 (335)
  2 PF11955 PORR:  Plant organelle  98.9   2E-08 4.2E-13  104.7  13.0  140  177-379    10-152 (335)
  3 KOG1832 HIV-1 Vpr-binding prot  87.8    0.51 1.1E-05   55.5   3.9  139  192-340  1156-1302(1516)
  4 PLN03196 MOC1-like protein; Pr  86.6    0.38 8.3E-06   53.1   2.1   51  328-381   323-374 (487)
  5 PF04931 DNA_pol_phi:  DNA poly  85.6    0.82 1.8E-05   53.1   4.2   18  399-416   583-600 (784)
  6 PF05285 SDA1:  SDA1;  InterPro  81.1       1 2.2E-05   47.3   2.4   14  464-477   111-124 (324)
  7 PF06524 NOA36:  NOA36 protein;  79.9     2.5 5.4E-05   43.8   4.5   12  305-316   115-126 (314)
  8 PF11705 RNA_pol_3_Rpc31:  DNA-  79.3     1.5 3.2E-05   43.8   2.7   31  280-310    34-71  (233)
  9 PF10446 DUF2457:  Protein of u  77.8       2 4.3E-05   47.2   3.3   10  487-496   120-129 (458)
 10 PLN03196 MOC1-like protein; Pr  76.1     6.4 0.00014   43.7   6.7   51  331-386   361-414 (487)
 11 KOG0943 Predicted ubiquitin-pr  74.7     2.4 5.2E-05   51.6   3.1   15  249-263  1388-1402(3015)
 12 KOG1832 HIV-1 Vpr-binding prot  63.4       7 0.00015   46.6   3.7   12   50-61    962-973 (1516)
 13 PF06524 NOA36:  NOA36 protein;  62.6     9.3  0.0002   39.8   4.1    7  227-233    84-90  (314)
 14 PF11705 RNA_pol_3_Rpc31:  DNA-  61.0      12 0.00026   37.4   4.5    7  225-231    33-39  (233)
 15 KOG2038 CAATT-binding transcri  54.1      11 0.00023   44.4   3.2   11  105-115   326-336 (988)
 16 KOG1991 Nuclear transport rece  53.9     8.4 0.00018   46.1   2.3   17  101-117   521-537 (1010)
 17 PF04147 Nop14:  Nop14-like fam  53.1      17 0.00036   43.2   4.6    8  333-340   185-192 (840)
 18 PF12872 OST-HTH:  OST-HTH/LOTU  51.5      50  0.0011   26.4   5.9   49  104-155     7-66  (74)
 19 PF15017 AF1Q:  Drug resistance  44.9      17 0.00036   32.0   2.2   25  395-419    22-46  (87)
 20 KOG3064 RNA-binding nuclear pr  40.4      13 0.00028   38.7   1.1    9  368-376   126-134 (303)
 21 PF04147 Nop14:  Nop14-like fam  38.6      34 0.00074   40.6   4.2    8  407-414   281-288 (840)
 22 PHA02664 hypothetical protein;  37.6      43 0.00093   36.1   4.3   18  462-479   486-503 (534)
 23 COG5593 Nucleic-acid-binding p  36.3      19  0.0004   41.1   1.5   44  437-480   679-726 (821)
 24 PF04931 DNA_pol_phi:  DNA poly  36.3      32 0.00069   40.3   3.5    7  468-474   676-682 (784)
 25 COG5406 Nucleosome binding fac  34.6      21 0.00046   41.4   1.6   31  205-235   639-669 (1001)
 26 PF11702 DUF3295:  Protein of u  33.6      24 0.00051   39.8   1.7   19  466-484   310-329 (507)
 27 PF09073 BUD22:  BUD22;  InterP  32.3      65  0.0014   35.3   4.8   12  448-459   208-220 (432)
 28 KOG4364 Chromatin assembly fac  30.3      60  0.0013   37.9   4.2   48  403-450   476-536 (811)
 29 PF05285 SDA1:  SDA1;  InterPro  29.8      21 0.00045   37.7   0.5   20  371-390    35-54  (324)
 30 KOG1999 RNA polymerase II tran  28.9      53  0.0012   39.7   3.6    6  468-473    81-86  (1024)
 31 PF02724 CDC45:  CDC45-like pro  28.3      52  0.0011   37.9   3.4   31  382-415    96-126 (622)
 32 PF06957 COPI_C:  Coatomer (COP  26.9      21 0.00046   39.3   0.0   12  463-474    70-81  (422)
 33 KOG2393 Transcription initiati  24.8      64  0.0014   36.7   3.1   40  438-477   242-296 (555)
 34 KOG2652 RNA polymerase II tran  22.9      79  0.0017   34.1   3.3    9  304-312   135-143 (348)
 35 PHA00458 single-stranded DNA-b  21.9      85  0.0018   32.1   3.1   23  381-403   121-143 (233)

No 1  
>PF11955 PORR:  Plant organelle RNA recognition domain;  InterPro: IPR021099 The plant organelle RNA recognition (PORR) domain, previously known as DUF860, is a component of group II intron ribonucleoprotein particles in maize chloroplasts. It is required for the splicing of the introns with which it associates, and promotes splicing in the context of a heterodimer with the RNase III-domain protein RNC1. Proteins containing this domain are predicted to localise to mitochondria or chloroplasts []. It seems likely that most PORR proteins function in organellar RNA metabolism [].
Probab=100.00  E-value=2.6e-113  Score=878.45  Aligned_cols=332  Identities=50%  Similarity=0.839  Sum_probs=313.9

Q ss_pred             cccCCChhhHHHhhhhhhHHHHHHHHHhhCCCCcccHHHHhhcccccCCCccchHHHHHHhCCcceEEeecCce-eeeee
Q 009820           85 RRKELPFDNVIQRDKKLKLVSKIRKILVSQPDRIMSLKQLGRFRRDLGLTKKRRFIALLRKFPAVFEIIEEGVY-SLRFK  163 (524)
Q Consensus        85 w~kD~~LD~~i~rek~lr~vl~Lk~lI~s~P~~~lpl~~Lsk~r~~LgL~~~~~v~~FLrkYP~iF~vf~~~~~-~l~~r  163 (524)
                      |+||++||++|+++|++++|++|+++|+++|+++|||++|++++++||| .++++++||+|||+||++|.++.. .+||+
T Consensus         1 w~rd~~lD~~i~~~k~l~~v~~l~~~i~~~p~~~~pl~~l~k~~~~L~l-~~~~~~~flrkyP~iF~~~~~~~~~~~~~~   79 (335)
T PF11955_consen    1 WVRDPYLDKVIEREKRLRFVLRLKDLILSQPSHSLPLRDLSKLRRQLGL-KPRKVSRFLRKYPSIFEVFQHPSRSVPWFR   79 (335)
T ss_pred             CCCchhHHHHHHhhhhHHHHHHHHHHHHcCCCCcccHHHHHHHHHhcCC-CcccHHHHHHhCCceEEEeccCCCCCceEE
Confidence            9999999999999999999999999999999999999999999999999 457899999999999999997655 56999


Q ss_pred             cCHHHHHHHHHHHHHHhhchHHHHHHHHHHhccccCccccHHHHHHHHHhcCCChhhhhhhcccCCCceEEEecC-CCCe
Q 009820          164 LTPEAERLYLEEVKVRNEMEDLLVTKLRKLLMMSLEKRILLEKIAHLKTDLGLPLEFRDTICHRYPQYFRVVATE-RGPA  242 (524)
Q Consensus       164 LT~~A~~L~~EE~~v~~e~e~~~V~rLrKLLMMS~~rrLpL~kL~~lr~dLGLP~DFr~slv~kyPd~Frvv~~~-~g~~  242 (524)
                      ||++|++|+.||+++++++++++|+||+||||||.+++|||++|+|++||||||+||++++|++|||||+||+.+ ++.+
T Consensus        80 LT~~a~~L~~eE~~~~~~~e~~~v~rL~KLLMMS~~~rlpL~ki~~l~~dLGLP~Df~~~lv~~yP~~Frvv~~~~~~~~  159 (335)
T PF11955_consen   80 LTPEAEDLLREERRVREEMEPDLVERLRKLLMMSKDRRLPLSKIAHLRRDLGLPDDFRDSLVPKYPDYFRVVDLEDGGRY  159 (335)
T ss_pred             eCHHHHHHHHHHHHHHHhChHHHHHHHHHHhccCCCCcccHHHHHHHHHHcCCChhhccchhhhCCCCcEEeecCCCCCE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999954 4589


Q ss_pred             eEecccCCCCcchHHHHHHHHhhhHhhhhccccccCCCCCCcccCCCCcccChhHHHHHhhhhcCCCCCCCCCCCCCCCC
Q 009820          243 LELTHWDPQLAVSAAELAAEENRIRELKEKDLIIDRPLKFNRVKLPKGLNLSKGETRRICQFRDMPYISPYSDFSGLRPG  322 (524)
Q Consensus       243 LELV~WdpeLAVSa~E~~ae~~r~~e~~e~~~~i~~plkF~~v~fP~Gf~l~k~~~~~L~~fQ~LPYiSPYed~s~l~~~  322 (524)
                      ||||+|||+||||++|++++.+..   ...+..+..+++| ||+||+||++++++++||++||+|||+|||+|+++++++
T Consensus       160 LeLv~Wd~~LAvs~~E~~~~~~~~---~~~~~~~~~~~~F-p~~fp~G~~l~k~~~~~l~~fQ~lPy~SPYed~~~l~~~  235 (335)
T PF11955_consen  160 LELVSWDPELAVSALEKRAEKEYR---EKREDGFDRPLAF-PVSFPKGFRLKKKFREWLEEFQKLPYISPYEDASHLDPG  235 (335)
T ss_pred             EEEeecCCccCcCccchhhhhccc---cccccccCCceee-eecCCCCccccHHHHHHHHHHhcCCCCCCCCCccCCCCC
Confidence            999999999999999998875411   1123345678899 599999999999999999999999999999999999999


Q ss_pred             CchhhhHHHHHHHHHhhccchhhhhhhHHHHHHhhhCChHHHHHhhhhCCCeeEEEeeCCceeEEEeeccCCCCCccCCh
Q 009820          323 TPEKEKHACGIVHEILSLTVEKKTLVDHLTHFREEFRFSQQVRGMLIRHPDMFYVSLKGDRDSVFLREAYRDSQLIDKDR  402 (524)
Q Consensus       323 S~e~EKRaVaVlHELLSLTVEKr~~v~~L~hFR~efgLp~k~r~~L~RHPgIFYVS~Kg~~~TVfLREAY~~~~LIek~P  402 (524)
                      |+++|||||||+||||||||||||++++|+|||+|||||++|+++|+|||||||||+||+|+||||||||++|+||||||
T Consensus       236 s~~~EKRaVaVlHElLSLTveKr~~~~~L~~fr~ef~lp~k~~~~l~rHPgIFYvS~kg~~~TVfLrEAY~~~~Liek~P  315 (335)
T PF11955_consen  236 SDEAEKRAVAVLHELLSLTVEKRTEVDHLTHFRKEFGLPQKFRRLLLRHPGIFYVSLKGKRHTVFLREAYDGGELIEKHP  315 (335)
T ss_pred             ChHHHhHHHHHHHHHHHhhhhhhccHHHHHHHHHHhCCcHHHHHHHHhCCCeEEEeccCCceEEEEeeccCCCCCCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHHHHHHHHHHcCCCcCC
Q 009820          403 LLVIKEKFRALVSVPRFPK  421 (524)
Q Consensus       403 L~~iReK~~~Lm~~~~~~~  421 (524)
                      |+.+|+||++||..|++.+
T Consensus       316 l~~~r~k~~~Lm~~~~~~~  334 (335)
T PF11955_consen  316 LVVIREKFLELMQEGRRKR  334 (335)
T ss_pred             hHHHHHHHHHHHhhccccc
Confidence            9999999999999998744


No 2  
>PF11955 PORR:  Plant organelle RNA recognition domain;  InterPro: IPR021099 The plant organelle RNA recognition (PORR) domain, previously known as DUF860, is a component of group II intron ribonucleoprotein particles in maize chloroplasts. It is required for the splicing of the introns with which it associates, and promotes splicing in the context of a heterodimer with the RNase III-domain protein RNC1. Proteins containing this domain are predicted to localise to mitochondria or chloroplasts []. It seems likely that most PORR proteins function in organellar RNA metabolism [].
Probab=98.87  E-value=2e-08  Score=104.71  Aligned_cols=140  Identities=23%  Similarity=0.415  Sum_probs=108.6

Q ss_pred             HHHhhchHHHHHHHHHHhccccCccccHHHHHHHHHhcCCChhhhhhhcccCCCceEEEecC-CC-CeeEecccCCCCcc
Q 009820          177 KVRNEMEDLLVTKLRKLLMMSLEKRILLEKIAHLKTDLGLPLEFRDTICHRYPQYFRVVATE-RG-PALELTHWDPQLAV  254 (524)
Q Consensus       177 ~v~~e~e~~~V~rLrKLLMMS~~rrLpL~kL~~lr~dLGLP~DFr~slv~kyPd~Frvv~~~-~g-~~LELV~WdpeLAV  254 (524)
                      .+..+.....|.+|+.+|--++++.||++.+...+..|||+.-=..+++.+||..|.+...+ .+ .++.|+.       
T Consensus        10 ~i~~~k~l~~v~~l~~~i~~~p~~~~pl~~l~k~~~~L~l~~~~~~~flrkyP~iF~~~~~~~~~~~~~~LT~-------   82 (335)
T PF11955_consen   10 VIEREKRLRFVLRLKDLILSQPSHSLPLRDLSKLRRQLGLKPRKVSRFLRKYPSIFEVFQHPSRSVPWFRLTP-------   82 (335)
T ss_pred             HHHhhhhHHHHHHHHHHHHcCCCCcccHHHHHHHHHhcCCCcccHHHHHHhCCceEEEeccCCCCCceEEeCH-------
Confidence            35556667789999999999999999999999999999994333357899999999998742 22 4555532       


Q ss_pred             hHHHHHHHHhhhHhhhhccccccCCCCCCcccCCCCcccChhHHHHHhhhhcCCCCCCCCCCCCCCCCCchhhhHHHHHH
Q 009820          255 SAAELAAEENRIRELKEKDLIIDRPLKFNRVKLPKGLNLSKGETRRICQFRDMPYISPYSDFSGLRPGTPEKEKHACGIV  334 (524)
Q Consensus       255 Sa~E~~ae~~r~~e~~e~~~~i~~plkF~~v~fP~Gf~l~k~~~~~L~~fQ~LPYiSPYed~s~l~~~S~e~EKRaVaVl  334 (524)
                      .|.+...+|.++                                                        -.+.|--+|..+
T Consensus        83 ~a~~L~~eE~~~--------------------------------------------------------~~~~e~~~v~rL  106 (335)
T PF11955_consen   83 EAEDLLREERRV--------------------------------------------------------REEMEPDLVERL  106 (335)
T ss_pred             HHHHHHHHHHHH--------------------------------------------------------HHhChHHHHHHH
Confidence            222222222211                                                        122345678899


Q ss_pred             HHHhhccchhhhhhhHHHHHHhhhCChHHHHHh-hhhCCCeeEEEe
Q 009820          335 HEILSLTVEKKTLVDHLTHFREEFRFSQQVRGM-LIRHPDMFYVSL  379 (524)
Q Consensus       335 HELLSLTVEKr~~v~~L~hFR~efgLp~k~r~~-L~RHPgIFYVS~  379 (524)
                      .-||+|+..+|+.+.+|.|++.+||||..|+.- +-+||+.|=|..
T Consensus       107 ~KLLMMS~~~rlpL~ki~~l~~dLGLP~Df~~~lv~~yP~~Frvv~  152 (335)
T PF11955_consen  107 RKLLMMSKDRRLPLSKIAHLRRDLGLPDDFRDSLVPKYPDYFRVVD  152 (335)
T ss_pred             HHHhccCCCCcccHHHHHHHHHHcCCChhhccchhhhCCCCcEEee
Confidence            999999999999999999999999999999986 699999998877


No 3  
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=87.81  E-value=0.51  Score=55.53  Aligned_cols=139  Identities=17%  Similarity=0.163  Sum_probs=73.8

Q ss_pred             HHhccccCccccHHHHHHHHHhcCCChhhhhhhcccCC--CceEEEecCCCCeeEecccCCCCcchHHHHHHHHhhhHhh
Q 009820          192 KLLMMSLEKRILLEKIAHLKTDLGLPLEFRDTICHRYP--QYFRVVATERGPALELTHWDPQLAVSAAELAAEENRIREL  269 (524)
Q Consensus       192 KLLMMS~~rrLpL~kL~~lr~dLGLP~DFr~slv~kyP--d~Frvv~~~~g~~LELV~WdpeLAVSa~E~~ae~~r~~e~  269 (524)
                      -++..|..-+=||..|+.+..-+|--+-|...=+.+|.  -.||++.+....++-   +|-+ .-+.++..--. -....
T Consensus      1156 s~~Ltsss~S~PlsaLW~~~s~~~~~Hsf~ed~~vkFsn~~q~r~~gt~~d~a~~---YDvq-T~~~l~tylt~-~~~~~ 1230 (1516)
T KOG1832|consen 1156 STQLTSSSSSSPLSALWDASSTGGPRHSFDEDKAVKFSNSLQFRALGTEADDALL---YDVQ-TCSPLQTYLTD-TVTSS 1230 (1516)
T ss_pred             ceeeeeccccCchHHHhccccccCccccccccceeehhhhHHHHHhcccccceEE---Eecc-cCcHHHHhcCc-chhhh
Confidence            45566677788999999999999999999976666664  468888775432110   0100 11111110000 00000


Q ss_pred             hhccccccCCCCCCc---ccCCCCcccChhHHHHHhhhhcCC-CCCCCCCCC--CCCCCCchhhhHHHHHHHHHhhc
Q 009820          270 KEKDLIIDRPLKFNR---VKLPKGLNLSKGETRRICQFRDMP-YISPYSDFS--GLRPGTPEKEKHACGIVHEILSL  340 (524)
Q Consensus       270 ~e~~~~i~~plkF~~---v~fP~Gf~l~k~~~~~L~~fQ~LP-YiSPYed~s--~l~~~S~e~EKRaVaVlHELLSL  340 (524)
                      .+++     .-.|+|   +-|-.|.=-..+..+.+..|-++- |++----.+  .+--+|..-+-|+.-.+|-+=+|
T Consensus      1231 y~~n-----~a~FsP~D~LIlndGvLWDvR~~~aIh~FD~ft~~~~G~FHP~g~eVIINSEIwD~RTF~lLh~VP~L 1302 (1516)
T KOG1832|consen 1231 YSNN-----LAHFSPCDTLILNDGVLWDVRIPEAIHRFDQFTDYGGGGFHPSGNEVIINSEIWDMRTFKLLHSVPSL 1302 (1516)
T ss_pred             hhcc-----ccccCCCcceEeeCceeeeeccHHHHhhhhhheecccccccCCCceEEeechhhhhHHHHHHhcCccc
Confidence            0111     123443   334556544444556777777665 222111111  13335666777888888876665


No 4  
>PLN03196 MOC1-like protein; Provisional
Probab=86.55  E-value=0.38  Score=53.07  Aligned_cols=51  Identities=24%  Similarity=0.371  Sum_probs=39.3

Q ss_pred             hHHHHHHHHHhhccchhhhhhhHHHHHHhhhCChH-HHHHhhhhCCCeeEEEeeC
Q 009820          328 KHACGIVHEILSLTVEKKTLVDHLTHFREEFRFSQ-QVRGMLIRHPDMFYVSLKG  381 (524)
Q Consensus       328 KRaVaVlHELLSLTVEKr~~v~~L~hFR~efgLp~-k~r~~L~RHPgIFYVS~Kg  381 (524)
                      .++|.-+-.+|++..+|  ...++..|++ +|++. .+..|+.++|.++-.|.+.
T Consensus       323 ~~~v~k~P~il~lSe~k--l~~kvefL~~-~Gls~edI~~mv~k~P~lL~~S~~~  374 (487)
T PLN03196        323 GRVIEKLPQIVSLNRNV--ALKHVEFLRG-RGFSAQDVAKMVVRCPQILALNLEI  374 (487)
T ss_pred             HHHHHhcchhhcccHHH--HHHHHHHHHH-cCCCHHHHHHHHHhCCceeeccHHH
Confidence            34566667888888764  3467888875 99985 8889999999999999843


No 5  
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=85.57  E-value=0.82  Score=53.09  Aligned_cols=18  Identities=22%  Similarity=0.219  Sum_probs=10.0

Q ss_pred             cCChHhHHHHHHHHHHcC
Q 009820          399 DKDRLLVIKEKFRALVSV  416 (524)
Q Consensus       399 ek~PL~~iReK~~~Lm~~  416 (524)
                      |++++..+=|=++.|+..
T Consensus       583 e~~~~~vlveiLLslls~  600 (784)
T PF04931_consen  583 EPEWSEVLVEILLSLLSQ  600 (784)
T ss_pred             CccHHHHHHHHHHHHHhC
Confidence            456666665555555543


No 6  
>PF05285 SDA1:  SDA1;  InterPro: IPR007949 This domain consists of several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localised in the nucleus [].
Probab=81.08  E-value=1  Score=47.26  Aligned_cols=14  Identities=36%  Similarity=0.881  Sum_probs=8.2

Q ss_pred             CCCCCCCCCCCCCC
Q 009820          464 DDGNEDDWSDEDDD  477 (524)
Q Consensus       464 ~~~~~~~~~~~~~~  477 (524)
                      |+|++++|.+++++
T Consensus       111 d~Dd~~e~idv~~d  124 (324)
T PF05285_consen  111 DSDDEGEWIDVESD  124 (324)
T ss_pred             cccccCCcccccch
Confidence            33446777777555


No 7  
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=79.87  E-value=2.5  Score=43.83  Aligned_cols=12  Identities=17%  Similarity=0.224  Sum_probs=5.7

Q ss_pred             hcCCCCCCCCCC
Q 009820          305 RDMPYISPYSDF  316 (524)
Q Consensus       305 Q~LPYiSPYed~  316 (524)
                      +......|..|+
T Consensus       115 ~~HaC~Cpl~da  126 (314)
T PF06524_consen  115 STHACTCPLQDA  126 (314)
T ss_pred             ccccccCcCCCc
Confidence            344455555444


No 8  
>PF11705 RNA_pol_3_Rpc31:  DNA-directed RNA polymerase III subunit Rpc31;  InterPro: IPR024661 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. RNA polymerase III contains seventeen subunits in yeasts and in human cells. Twelve of these are akin to RNA polymerase I or II and the other five are RNA polymerase III-specific, and form the functionally distinct groups: (i) Rpc31-Rpc34-Rpc82, and (ii) Rpc37-Rpc53. Rpc31, Rpc34 and Rpc82 form a cluster of enzyme-specific subunits that contribute to transcription initiation in Saccharomyces cerevisiae and Homo sapiens. There is evidence that these subunits are anchored at or near the N-terminal Zn-fold of Rpc1, itself prolonged by a highly conserved but RNA polymerase III-specific domain []. This entry represents the Rpc31 subunit.
Probab=79.25  E-value=1.5  Score=43.78  Aligned_cols=31  Identities=32%  Similarity=0.436  Sum_probs=16.1

Q ss_pred             CCCCcccCCCCcccChhHHH-------HHhhhhcCCCC
Q 009820          280 LKFNRVKLPKGLNLSKGETR-------RICQFRDMPYI  310 (524)
Q Consensus       280 lkF~~v~fP~Gf~l~k~~~~-------~L~~fQ~LPYi  310 (524)
                      +-|+++.+|.-..+......       -...|+..||-
T Consensus        34 ~lfP~~~~P~~~~~t~~E~~~v~~~~~lr~~~~~sPyy   71 (233)
T PF11705_consen   34 PLFPPLNLPVPLPLTEEERYLVALKRELRERMRDSPYY   71 (233)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHhCCCc
Confidence            44555556655555543322       12467777763


No 9  
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=77.79  E-value=2  Score=47.23  Aligned_cols=10  Identities=0%  Similarity=-0.114  Sum_probs=5.9

Q ss_pred             cceeeecccc
Q 009820          487 GTVKIGENKS  496 (524)
Q Consensus       487 ~~~~~~~~~~  496 (524)
                      +...||.-.+
T Consensus       120 sd~~~WtP~~  129 (458)
T PF10446_consen  120 SDYEFWTPGA  129 (458)
T ss_pred             ccceeecccc
Confidence            3566776553


No 10 
>PLN03196 MOC1-like protein; Provisional
Probab=76.09  E-value=6.4  Score=43.69  Aligned_cols=51  Identities=22%  Similarity=0.331  Sum_probs=38.2

Q ss_pred             HHHHHHHhhccchhhhhhhHHHHHHhhhCChHHHHHhhhhCCCeeEEEeeCC---ceeE
Q 009820          331 CGIVHEILSLTVEKKTLVDHLTHFREEFRFSQQVRGMLIRHPDMFYVSLKGD---RDSV  386 (524)
Q Consensus       331 VaVlHELLSLTVEKr~~v~~L~hFR~efgLp~k~r~~L~RHPgIFYVS~Kg~---~~TV  386 (524)
                      |.-.=-+|++.+  .....++.-|.+++|++.   +.+.++|.+|-.|+..+   ||.|
T Consensus       361 v~k~P~lL~~S~--~~l~~k~dFlvneMg~~~---~~Iv~fP~~LsySLEkRI~PR~~~  414 (487)
T PLN03196        361 VVRCPQILALNL--EIMKPSLEFFKKEMKRPL---KELVEFPAYFTYGLESRIKPRYER  414 (487)
T ss_pred             HHhCCceeeccH--HHHHHHHHHHHHHhCCCH---HHHHhChHHhccChhhhhHHHHHH
Confidence            333445677776  455788999999999994   44899999998888755   4665


No 11 
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=74.73  E-value=2.4  Score=51.62  Aligned_cols=15  Identities=27%  Similarity=0.381  Sum_probs=10.4

Q ss_pred             CCCCcchHHHHHHHH
Q 009820          249 DPQLAVSAAELAAEE  263 (524)
Q Consensus       249 dpeLAVSa~E~~ae~  263 (524)
                      .|.+|.+++|.--..
T Consensus      1388 PPkFAk~ALEqcckd 1402 (3015)
T KOG0943|consen 1388 PPKFAKLALEQCCKD 1402 (3015)
T ss_pred             CchHHHHHHHHHHHH
Confidence            467888999874433


No 12 
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=63.37  E-value=7  Score=46.63  Aligned_cols=12  Identities=8%  Similarity=0.066  Sum_probs=5.2

Q ss_pred             cccccccccccC
Q 009820           50 SQFWGKGLVLHK   61 (524)
Q Consensus        50 ~~fl~~~~~~~~   61 (524)
                      +.|.+.+++-++
T Consensus       962 s~l~~~~~p~re  973 (1516)
T KOG1832|consen  962 SELRDSSVPGRE  973 (1516)
T ss_pred             ccccCccccccc
Confidence            344444444443


No 13 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=62.63  E-value=9.3  Score=39.78  Aligned_cols=7  Identities=29%  Similarity=0.610  Sum_probs=4.2

Q ss_pred             cCCCceE
Q 009820          227 RYPQYFR  233 (524)
Q Consensus       227 kyPd~Fr  233 (524)
                      +||..|.
T Consensus        84 kH~g~~~   90 (314)
T PF06524_consen   84 KHPGVFT   90 (314)
T ss_pred             ecCceee
Confidence            6666654


No 14 
>PF11705 RNA_pol_3_Rpc31:  DNA-directed RNA polymerase III subunit Rpc31;  InterPro: IPR024661 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. RNA polymerase III contains seventeen subunits in yeasts and in human cells. Twelve of these are akin to RNA polymerase I or II and the other five are RNA polymerase III-specific, and form the functionally distinct groups: (i) Rpc31-Rpc34-Rpc82, and (ii) Rpc37-Rpc53. Rpc31, Rpc34 and Rpc82 form a cluster of enzyme-specific subunits that contribute to transcription initiation in Saccharomyces cerevisiae and Homo sapiens. There is evidence that these subunits are anchored at or near the N-terminal Zn-fold of Rpc1, itself prolonged by a highly conserved but RNA polymerase III-specific domain []. This entry represents the Rpc31 subunit.
Probab=61.04  E-value=12  Score=37.43  Aligned_cols=7  Identities=14%  Similarity=0.292  Sum_probs=3.9

Q ss_pred             cccCCCc
Q 009820          225 CHRYPQY  231 (524)
Q Consensus       225 v~kyPd~  231 (524)
                      .+-||.+
T Consensus        33 ~~lfP~~   39 (233)
T PF11705_consen   33 PPLFPPL   39 (233)
T ss_pred             CCCCCCC
Confidence            3456666


No 15 
>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription]
Probab=54.05  E-value=11  Score=44.40  Aligned_cols=11  Identities=27%  Similarity=0.597  Sum_probs=4.6

Q ss_pred             HHHHHHHhhCC
Q 009820          105 SKIRKILVSQP  115 (524)
Q Consensus       105 l~Lk~lI~s~P  115 (524)
                      -.|.++|-++|
T Consensus       326 ~ti~~lL~~kP  336 (988)
T KOG2038|consen  326 KTIYDLLTNKP  336 (988)
T ss_pred             HHHHHHHhCCc
Confidence            33344444444


No 16 
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]
Probab=53.90  E-value=8.4  Score=46.09  Aligned_cols=17  Identities=6%  Similarity=0.198  Sum_probs=12.3

Q ss_pred             hhHHHHHHHHHhhCCCC
Q 009820          101 LKLVSKIRKILVSQPDR  117 (524)
Q Consensus       101 lr~vl~Lk~lI~s~P~~  117 (524)
                      +-.++.|+.+|.+++..
T Consensus       521 VeAalALq~fI~~~~~~  537 (1010)
T KOG1991|consen  521 VEAALALQSFISNQEQA  537 (1010)
T ss_pred             hHHHHHHHHHHhcchhh
Confidence            34688888888887743


No 17 
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=53.13  E-value=17  Score=43.17  Aligned_cols=8  Identities=25%  Similarity=0.605  Sum_probs=3.8

Q ss_pred             HHHHHhhc
Q 009820          333 IVHEILSL  340 (524)
Q Consensus       333 VlHELLSL  340 (524)
                      |+.|+..=
T Consensus       185 vm~EiIaK  192 (840)
T PF04147_consen  185 VMEEIIAK  192 (840)
T ss_pred             HHHHHHHH
Confidence            44454443


No 18 
>PF12872 OST-HTH:  OST-HTH/LOTUS domain; PDB: 2KPM_A 3S93_B 3RCO_A 2KZV_A.
Probab=51.54  E-value=50  Score=26.40  Aligned_cols=49  Identities=39%  Similarity=0.539  Sum_probs=33.8

Q ss_pred             HHHHHHHHhhCCC--CcccHHHHhhc---------ccccCCCccchHHHHHHhCCcceEEeec
Q 009820          104 VSKIRKILVSQPD--RIMSLKQLGRF---------RRDLGLTKKRRFIALLRKFPAVFEIIEE  155 (524)
Q Consensus       104 vl~Lk~lI~s~P~--~~lpl~~Lsk~---------r~~LgL~~~~~v~~FLrkYP~iF~vf~~  155 (524)
                      .-.|+++|.+.++  +.+++..|...         -+.+|+.   ++..||+..|.+|++-..
T Consensus         7 ~~~l~~ll~~~~~~~g~v~ls~l~~~~~~~~~~f~~~~yG~~---~l~~ll~~~~~~~~i~~~   66 (74)
T PF12872_consen    7 KKLLRELLESQKGEDGWVSLSQLGQEYKKKYPDFDPRDYGFS---SLSELLESLPDVVEIEER   66 (74)
T ss_dssp             HHHHHHHHHHTCTTTSSEEHHHHHHHHHHHHTT--TCCTTSS---SHHHHHHT-TTTEEEEEE
T ss_pred             HHHHHHHHHhCcCCCceEEHHHHHHHHHHHCCCCCccccCCC---cHHHHHHhCCCeEEEeee
Confidence            3456777756654  37888888544         2456665   589999999999999433


No 19 
>PF15017 AF1Q:  Drug resistance and apoptosis regulator
Probab=44.91  E-value=17  Score=32.01  Aligned_cols=25  Identities=20%  Similarity=0.163  Sum_probs=15.4

Q ss_pred             CCCccCChHhHHHHHHHHHHcCCCc
Q 009820          395 SQLIDKDRLLVIKEKFRALVSVPRF  419 (524)
Q Consensus       395 ~~LIek~PL~~iReK~~~Lm~~~~~  419 (524)
                      +.+-=++||-.|=.-+++|+.+...
T Consensus        22 sF~fWR~PlP~id~~~lEll~~~~~   46 (87)
T PF15017_consen   22 SFLFWRNPLPDIDLELLELLGLDKS   46 (87)
T ss_pred             ceeeccCCCCCCCHHHHhhhccccc
Confidence            3444567777776677777754433


No 20 
>KOG3064 consensus RNA-binding nuclear protein (MAK16) containing a distinct C4 Zn-finger [RNA processing and modification]
Probab=40.39  E-value=13  Score=38.65  Aligned_cols=9  Identities=11%  Similarity=0.010  Sum_probs=3.4

Q ss_pred             hhhCCCeeE
Q 009820          368 LIRHPDMFY  376 (524)
Q Consensus       368 L~RHPgIFY  376 (524)
                      -+||-.--|
T Consensus       126 alr~~q~~~  134 (303)
T KOG3064|consen  126 ALRGRQKKL  134 (303)
T ss_pred             HhccCceEE
Confidence            344333333


No 21 
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=38.61  E-value=34  Score=40.63  Aligned_cols=8  Identities=38%  Similarity=0.567  Sum_probs=3.7

Q ss_pred             HHHHHHHH
Q 009820          407 KEKFRALV  414 (524)
Q Consensus       407 ReK~~~Lm  414 (524)
                      ++|+-.|=
T Consensus       281 ~erLeklE  288 (840)
T PF04147_consen  281 KERLEKLE  288 (840)
T ss_pred             HHHHHHHH
Confidence            44444443


No 22 
>PHA02664 hypothetical protein; Provisional
Probab=37.64  E-value=43  Score=36.15  Aligned_cols=18  Identities=39%  Similarity=0.713  Sum_probs=11.4

Q ss_pred             CCCCCCCCCCCCCCCCCC
Q 009820          462 DVDDGNEDDWSDEDDDMP  479 (524)
Q Consensus       462 ~~~~~~~~~~~~~~~~~~  479 (524)
                      |++|..+|.|.|+.|.+-
T Consensus       486 de~ds~ddswgd~sdsgi  503 (534)
T PHA02664        486 DESDSADDSWGDESDSGI  503 (534)
T ss_pred             ccccccccccccccccCc
Confidence            344455788988866543


No 23 
>COG5593 Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis]
Probab=36.26  E-value=19  Score=41.10  Aligned_cols=44  Identities=30%  Similarity=0.395  Sum_probs=28.3

Q ss_pred             CCCCCCCCCCCccc--ccc--ccccCCCCCCCCCCCCCCCCCCCCCCC
Q 009820          437 EPEEGSGEDGEDWS--IDD--YMTDGQFDDVDDGNEDDWSDEDDDMPP  480 (524)
Q Consensus       437 ~~~~~~~~~~~~~~--~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (524)
                      -|+|+|-+++|-|+  |+.  =++++.++.+=|..+||.+|-+.|++|
T Consensus       679 ~d~d~emde~eiw~alv~srp~~e~d~ddse~d~~e~d~sd~~sd~e~  726 (821)
T COG5593         679 FDSDDEMDENEIWSALVKSRPDVEDDSDDSELDFAEDDFSDSTSDDEP  726 (821)
T ss_pred             cCccccccHHHHHHHHhccCCccccCccccccchhhccccccCCCccc
Confidence            46677778888898  777  345554444444567788877555444


No 24 
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=36.25  E-value=32  Score=40.30  Aligned_cols=7  Identities=71%  Similarity=0.777  Sum_probs=3.0

Q ss_pred             CCCCCCC
Q 009820          468 EDDWSDE  474 (524)
Q Consensus       468 ~~~~~~~  474 (524)
                      ++|++++
T Consensus       676 e~d~e~~  682 (784)
T PF04931_consen  676 EDDDEDE  682 (784)
T ss_pred             ccccccc
Confidence            3444444


No 25 
>COG5406 Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics]
Probab=34.56  E-value=21  Score=41.37  Aligned_cols=31  Identities=13%  Similarity=-0.070  Sum_probs=19.3

Q ss_pred             HHHHHHHHhcCCChhhhhhhcccCCCceEEE
Q 009820          205 EKIAHLKTDLGLPLEFRDTICHRYPQYFRVV  235 (524)
Q Consensus       205 ~kL~~lr~dLGLP~DFr~slv~kyPd~Frvv  235 (524)
                      +....+-+-+|.|+-|-+..+.-.|+-=|++
T Consensus       639 eqdKlie~k~~rt~~~~~~~vRp~~d~KR~p  669 (1001)
T COG5406         639 EQDKLIERKLSRTDVYMKTDVRPGSDGKRKP  669 (1001)
T ss_pred             hhhhhhhccccccchhhhcccccCCCcCccC
Confidence            3344556778888888777666555544443


No 26 
>PF11702 DUF3295:  Protein of unknown function (DUF3295);  InterPro: IPR021711  This family is conserved in fungi but the function is not known. 
Probab=33.56  E-value=24  Score=39.78  Aligned_cols=19  Identities=26%  Similarity=0.669  Sum_probs=9.7

Q ss_pred             CCCCCCCCC-CCCCCCCCCC
Q 009820          466 GNEDDWSDE-DDDMPPDFDE  484 (524)
Q Consensus       466 ~~~~~~~~~-~~~~~~~~~~  484 (524)
                      |+++||+|- +|.|.+.-||
T Consensus       310 DDssDWEDSveESG~sSvde  329 (507)
T PF11702_consen  310 DDSSDWEDSVEESGKSSVDE  329 (507)
T ss_pred             ccchhhhhccccccCCCccc
Confidence            336788443 4444444444


No 27 
>PF09073 BUD22:  BUD22;  InterPro: IPR015158 BUD22 has been shown in yeast to be a nuclear protein involved in bud-site selection. It plays a role in positioning the proximal bud pole signal []. 
Probab=32.27  E-value=65  Score=35.28  Aligned_cols=12  Identities=25%  Similarity=0.412  Sum_probs=6.6

Q ss_pred             ccc-cccccccCC
Q 009820          448 DWS-IDDYMTDGQ  459 (524)
Q Consensus       448 ~~~-~~~~~~~~~  459 (524)
                      +.. .|+++-+++
T Consensus       208 ~~~q~d~~l~~Ss  220 (432)
T PF09073_consen  208 DLSQYDGLLASSS  220 (432)
T ss_pred             hhhhhhccccCCc
Confidence            344 667775443


No 28 
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=30.33  E-value=60  Score=37.91  Aligned_cols=48  Identities=19%  Similarity=0.059  Sum_probs=27.6

Q ss_pred             HhHHHHHHHHHHcCCCcCCCCC-------------CCCCCCCCCCCCCCCCCCCCCCCccc
Q 009820          403 LLVIKEKFRALVSVPRFPKRGA-------------PQKDDHYSDRTDEPEEGSGEDGEDWS  450 (524)
Q Consensus       403 L~~iReK~~~Lm~~~~~~~r~~-------------~~~~~~~~~g~~~~~~~~~~~~~~~~  450 (524)
                      -+.+|-||++...--|..|=|-             ........=..|.|+++|+++.|+..
T Consensus       476 ~r~mKaKlLqF~~NrRP~YyGTWrKKS~~VsarrPlAq~~llDYEVdSDeEWEEEepGESl  536 (811)
T KOG4364|consen  476 SRRMKAKLLQFDKNRRPGYYGTWRKKSQVVSARRPLAQDPLLDYEVDSDEEWEEEEPGESL  536 (811)
T ss_pred             cchhHHHHhhhccccCCcccccccccccccccCCcccccccccccccCcccccccCCCccc
Confidence            3448889999886433333221             11111112246778888888888775


No 29 
>PF05285 SDA1:  SDA1;  InterPro: IPR007949 This domain consists of several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localised in the nucleus [].
Probab=29.76  E-value=21  Score=37.70  Aligned_cols=20  Identities=10%  Similarity=0.233  Sum_probs=10.5

Q ss_pred             CCCeeEEEeeCCceeEEEee
Q 009820          371 HPDMFYVSLKGDRDSVFLRE  390 (524)
Q Consensus       371 HPgIFYVS~Kg~~~TVfLRE  390 (524)
                      +|.+.-=.-+|+..+.-++.
T Consensus        35 ~P~lL~kkdRGr~~~~~~~~   54 (324)
T PF05285_consen   35 NPELLHKKDRGRPAEMGAKP   54 (324)
T ss_pred             CHHhcCchhcCCcchhhhhc
Confidence            45554445566655555543


No 30 
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription]
Probab=28.87  E-value=53  Score=39.67  Aligned_cols=6  Identities=33%  Similarity=0.546  Sum_probs=2.3

Q ss_pred             CCCCCC
Q 009820          468 EDDWSD  473 (524)
Q Consensus       468 ~~~~~~  473 (524)
                      +|+|.|
T Consensus        81 dd~~~e   86 (1024)
T KOG1999|consen   81 DDDDEE   86 (1024)
T ss_pred             ccchhc
Confidence            333333


No 31 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=28.28  E-value=52  Score=37.87  Aligned_cols=31  Identities=10%  Similarity=0.209  Sum_probs=14.5

Q ss_pred             CceeEEEeeccCCCCCccCChHhHHHHHHHHHHc
Q 009820          382 DRDSVFLREAYRDSQLIDKDRLLVIKEKFRALVS  415 (524)
Q Consensus       382 ~~~TVfLREAY~~~~LIek~PL~~iReK~~~Lm~  415 (524)
                      ..+.|++-++....+|-   +.-.-++-|..+..
T Consensus        96 ~~~v~v~ddg~~~~~l~---~~~~~~~a~~~l~~  126 (622)
T PF02724_consen   96 NDQVIVFDDGDIEEELQ---EEPEYRDAYEALEE  126 (622)
T ss_pred             CCcEEEEECCChhhhcc---hhhhhHHHHHHhhh
Confidence            44555555544433322   12223666666664


No 32 
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=26.94  E-value=21  Score=39.32  Aligned_cols=12  Identities=25%  Similarity=0.659  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCC
Q 009820          463 VDDGNEDDWSDE  474 (524)
Q Consensus       463 ~~~~~~~~~~~~  474 (524)
                      +++++++.|.-+
T Consensus        70 ~~~~e~~gWD~d   81 (422)
T PF06957_consen   70 EDEDEEGGWDLD   81 (422)
T ss_dssp             ------------
T ss_pred             cccccccccccc
Confidence            344556778553


No 33 
>KOG2393 consensus Transcription initiation factor IIF, large subunit (RAP74) [Transcription]
Probab=24.77  E-value=64  Score=36.73  Aligned_cols=40  Identities=23%  Similarity=0.298  Sum_probs=23.4

Q ss_pred             CCCCCCCCCCcccc--cccc-------------ccCCCCCCCCCCCCCCCCCCCC
Q 009820          438 PEEGSGEDGEDWSI--DDYM-------------TDGQFDDVDDGNEDDWSDEDDD  477 (524)
Q Consensus       438 ~~~~~~~~~~~~~~--~~~~-------------~~~~~~~~~~~~~~~~~~~~~~  477 (524)
                      .++.++++++.|-.  ++=.             -.-+.||++-+.+|||++++..
T Consensus       242 ~~d~~d~e~e~~~kk~~~~kkk~~~~~~~~krkkk~d~Dd~a~eesdd~d~e~~E  296 (555)
T KOG2393|consen  242 SEDKKDGEVERWKKKHLDNKKKTTTAKGATKRKKKKDVDDEAFEESDDGDNEGRE  296 (555)
T ss_pred             hcccccccchhhhhccccccccccccccccccccccCCcccccccCCCccccccc
Confidence            56677778888874  2211             1112345555668888887543


No 34 
>KOG2652 consensus RNA polymerase II transcription initiation factor TFIIA, large chain [Transcription]
Probab=22.87  E-value=79  Score=34.15  Aligned_cols=9  Identities=33%  Similarity=0.674  Sum_probs=6.0

Q ss_pred             hhcCCCCCC
Q 009820          304 FRDMPYISP  312 (524)
Q Consensus       304 fQ~LPYiSP  312 (524)
                      +|--|+.+|
T Consensus       135 ~q~~p~~~p  143 (348)
T KOG2652|consen  135 TQPVPALSP  143 (348)
T ss_pred             cCCCcCcCc
Confidence            566666666


No 35 
>PHA00458 single-stranded DNA-binding protein
Probab=21.94  E-value=85  Score=32.15  Aligned_cols=23  Identities=17%  Similarity=0.291  Sum_probs=10.7

Q ss_pred             CCceeEEEeeccCCCCCccCChH
Q 009820          381 GDRDSVFLREAYRDSQLIDKDRL  403 (524)
Q Consensus       381 g~~~TVfLREAY~~~~LIek~PL  403 (524)
                      |+..+..|+=-=.+|..|.+.|.
T Consensus       121 Ge~~~i~l~v~DskGK~l~~vp~  143 (233)
T PHA00458        121 GENKPIVLRVVDSKGKRIEDVPA  143 (233)
T ss_pred             CcccccceeEEcCCCcCcCcCcc
Confidence            44444444332234555555554


Done!