BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 009885
         (523 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QZ6|A Chain A, First Crystal Structure Of A Psychrophile Class C Beta-
           Lactamase
          Length = 358

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 34/70 (48%), Gaps = 11/70 (15%)

Query: 449 ESSSPAAEKGGFTIGWVGKSY---LLG-------LLLVEIWGQFLHPYLLGDKFPFVPLM 498
           +S  P  E   F IG V K++   L G       L L +   Q+L P L GDKF  + L+
Sbjct: 45  DSKQPITENTLFEIGSVSKTFTATLAGYALANGKLKLSDPASQYL-PALRGDKFDHISLL 103

Query: 499 LISTYCAFGI 508
            + TY A G+
Sbjct: 104 NLGTYTAGGL 113


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.142    0.479 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,939,838
Number of Sequences: 62578
Number of extensions: 580151
Number of successful extensions: 1062
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1062
Number of HSP's gapped (non-prelim): 1
length of query: 523
length of database: 14,973,337
effective HSP length: 103
effective length of query: 420
effective length of database: 8,527,803
effective search space: 3581677260
effective search space used: 3581677260
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 54 (25.4 bits)