Citrus Sinensis ID: 009917

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520--

MEKKQIAIVGAGVSGLLACKYLLLKGFHPIVFEARSDIGGAWIKTVETTMLQTPKQLYQFSDYPWPDSVTTDFPDHNQVLDYIQSYASHFDLRKHIKFNRKVVGIEFEGLSGEDEKSWSFWNGNGQPFGSRGKWTVAVEDAKNHSTEVHQVDFVILCVGRFSDVPNIPEFPPKKGPEAFHGKVIHSMDYSDMDYEAAANLVKGKRVTVVGLQKSALDIAMECTTANGLENPCTVLYRTEHWNIPDYFPWGFPLAYLYLNRFAELLVHKPGEGFLLSLLATMLSPLRWAISKFVEADIKKKHRLAKFGMVPKHSFLQELSSCLTITVPEKFYDKVEEGSIILKKSQDFSFCEDGIVVDGQTTPLKTDLVILATGFKGDVKLKNIFLSQTFQDYLAGSPTEKLPLYREIIHPQIPQLAIIGFSESISNLYTSEMRCRWLAELLDGAVKLPSIKEMEEDMRKWDEYMKRYSGKYYRRSCIGALHIWYNDQLCKDMGWNPKRKKGWFAELFEPYGPVDYAPPSTSN

ccccEEEEEcccHHHHHHHHHHHHcccccEEEccccccccccccccccEEECcccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccccccccccccccccccccccEEEEEEEccccCEEEEEEcEEEEEEcccccccccccccccccccccccEEEEccccccccHHHHcccccccEEEEEccccHHHHHHHHHHHcccccccEEEEEccccEEccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcccEEEECcccEEEEcccEEEccccEECcccEEEEcccccccccccHHcccHHHcccccccccccHHccccccccccccEEEEEcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccCEEEccEEccccccccccccccccHHHHHHHcccccccccccccccc

**KKQIAIVGAGVSGLLACKYLLLKGFHPIVFEARSDIGGAWIKTVETTMLQTPKQLYQFSDYPWPDSVTTDFPDHNQVLDYIQSYASHFDLRKHIKFNRKVVGIEFEGLSGEDEKSWSFWNGNGQPFGSRGKWTVAVEDAKNHSTEVHQVDFVILCVGRFSDVPNIPEFPPKKGPEAFHGKVIHSMDYSDMDYEAAANLVKGKRVTVVGLQKSALDIAMECTTANGLENPCTVLYRTEHWNIPDYFPWGFPLAYLYLNRFAELLVHKPGEGFLLSLLATMLSPLRWAISKFVEADIKKKHRLAKFGMVPKHSFLQELSSCLTITVPEKFYDKVEEGSIILKKSQDFSFCEDGIVVDGQTTPLKTDLVILATGFKGDVKLKNIFLSQTFQDYLAGSPTEKLPLYREIIHPQIPQLAIIGFSESISNLYTSEMRCRWLAELLDGAVKLPSIKEMEEDMRKWDEYMKRYSGKYYRRSCIGALHIWYNDQLCKDMGWNPKRKKGWFAELFEPYGPVD*APPST**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable flavin-containing monooxygenase 1	Required for the establishment of systemic acquired resistance (SAR). Not involved in local defense mechanisms. Confers a salicylic acid-dependent (SA) resistance to virulent pathogens such as P.syringae pv tomato and H.parasitica.	probable	Q9LMA1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XVE, chain A
Confidence level:very confident
Coverage over the Query: 4-109,130-246,334-521
View the alignment between query and template
View the model in PyMOL

Template: 1W4X, chain A
Confidence level:very confident
Coverage over the Query: 3-109,130-486
View the alignment between query and template
View the model in PyMOL

Template: 3GWD, chain A
Confidence level:probable
Coverage over the Query: 8-125,147-244
View the alignment between query and template
View the model in PyMOL