Citrus Sinensis ID: 009930


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520--
MGALTSNRKRGDEYLNYQIPYQNLHISKRPRFNYTQQNQNQTLISSNSTVSRMSRYPEAKPPLKREVHAPCRTLKFGFADKSNQAFGSKKANGYGENQNLGIRMGNVLRYHLEKAKKSAFGAFRYFSKDKEVIDADNEQEKVEVISDDSSVEEIDAIEDGREGRSLVFDPRPRGSDENEKPVVDIGEIDGKSAEERNYHTNLQPSSSSVLTDTNNGDVSKMIDLLSLNGEMTVDVYKKLLQSVQKRGSKLKEIEFEIELNEKRWASLKQLWPLKKPEEEQVEELPREPFIPLTKEEEAAVERAFSANWRAVLVSHTETGIDITGKILQCLRPGAWLNDEVINVYLGLLKEREKREPQKFLKCHFFNTFFYNKLACGNKGYDFRAVKRWTSAKKLGYGLIECDKIFVPIHKQIHWCLAVIDRKDKKFQYLDSLKGRDKKVLGDLARYFVEEVRDKCGKDIDVSDWEQEFVLDLPEQANGFDCGMFMLKYVDFYSRGLGLCFDQSHMPYFRVRTAKEILRMRAD
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccEEEcccccHHHHHcccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccHHHHccccccccccccHHHHHHHHHHHccccccEEEccccccEEEEccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEccHHHHHHccccccccHHHHHHHHHHccccccccccccEEEEEEccccEEEEEEEccccccEEccccccccHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccc
*************YLNYQIPYQNLHI********************************************CRTLKF************************GIRMGNVLRYHLEKAKKSAFGAFRYFSKDK*****************************************************************************************KMIDLLSLNGEMTVDVYKKLLQSVQKRGSKLKEIEFEIELNEKRWASLKQLWPL*******************TKEEEAAVERAFSANWRAVLVSHTETGIDITGKILQCLRPGAWLNDEVINVYLGLLKEREKREPQKFLKCHFFNTFFYNKLACGNKGYDFRAVKRWTSAKKLGYGLIECDKIFVPIHKQIHWCLAVIDRKDKKFQYLDSLKGRDKKVLGDLARYFVEEVRDKCGKDIDVSDWEQEFVLDLPEQANGFDCGMFMLKYVDFYSRGLGLCFDQSHMPYFRVRTAKEILRMRA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGALTSNRKRGDEYLNYQIPYQNLHISKRPRFNYTQQNQNQTLISSNSTVSRMSRYPEAKPPLKREVHAPCRTLKFGFADKSNQAFGSKKANGYGENQNLGIRMGNVLRYHLEKAKKSAFGAFRYFSKDKEVIDADNEQEKVEVISDDSSVEEIDAIEDGREGRSLVFDPRPRGSDENEKPVVDIGEIDGKSAEERNYHTNLQPSSSSVLTDTNNGDVSKMIDLLSLNGEMTVDVYKKLLQSVQKRGSKLKEIEFEIELNEKRWASLKQLWPLKKPEEEQVEELPREPFIPLTKEEEAAVERAFSANWRAVLVSHTETGIDITGKILQCLRPGAWLNDEVINVYLGLLKEREKREPQKFLKCHFFNTFFYNKLACGNKGYDFRAVKRWTSAKKLGYGLIECDKIFVPIHKQIHWCLAVIDRKDKKFQYLDSLKGRDKKVLGDLARYFVEEVRDKCGKDIDVSDWEQEFVLDLPEQANGFDCGMFMLKYVDFYSRGLGLCFDQSHMPYFRVRTAKEILRMRAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-like-specific protease ESD4 Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMOs to their mature forms and deconjugation of SUMO from targeted proteins. Cleaves precursors of SUM1 and SUM2, but not of SUM3 or SUM5. Able to release SUM1 and SUM2 from conjugates, but unable to cleave SUM3. Acts predominantly as an isopeptidase, cleaving SUMO-conjugated proteins better than SUMO peptides. Plays an important role in the control of flowering time.probableQ94F30

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EAY, chain A
Confidence level:very confident
Coverage over the Query: 307-521
View the alignment between query and template
View the model in PyMOL
Template: 2XPH, chain A
Confidence level:very confident
Coverage over the Query: 287-520
View the alignment between query and template
View the model in PyMOL