Citrus Sinensis ID: 009941


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520--
MSGLTVARLQLFHYPSSTVRTTVISSKLHHSFPSSNRYRPRTLHNFSTSGIAQSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATKSEETSVEPKEKSSTSSSKVTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF
cccccccccccccccccccccHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccEEEEEEEcccccccccEEEEEEcccccccccccccccccccEEEEEEEECcccccccccccccccEEEEEEEcccccEEEEEEEccccEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHcccccccccEEEEEEECcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccEEEccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHccccccEEEccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccc
*****VARLQLFHYPSSTVRTTVI***********************************IVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATKSE****************VTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGLTVARLQLFHYPSSTVRTTVISSKLHHSFPSSNRYRPRTLHNFSTSGIAQSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATKSEETSVEPKEKSSTSSSKVTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aspartyl aminopeptidase Likely to play an important role in intracellular protein and peptide metabolism.probableQ5RBT2
Probable M18 family aminopeptidase 2 probableQ97LF4
Aspartyl aminopeptidase Likely to play an important role in intracellular protein and peptide metabolism.probableQ9ULA0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.11.-Aminopeptidases.probable
3.4.11.21Aspartyl aminopeptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EME, chain A
Confidence level:very confident
Coverage over the Query: 260-521
View the alignment between query and template
View the model in PyMOL
Template: 2GLJ, chain A
Confidence level:very confident
Coverage over the Query: 36-509
View the alignment between query and template
View the model in PyMOL