Citrus Sinensis ID: 009954

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-
MSGRDIRYDAVGEGSRHKSSWVSGRSRTGERGRDRHHRDFKSGGDDRRRDKNYKYDREGIRDHDRTDRHRDYNRDKERRHRHRSRSHSSDRFRNRSKSLSPSRSPSKSKRRSGFDMAPPAAAMLPGAAVPGQLPGVPSAVPEMAQNMLPFGATQLGAFPLMPVQVMTQQATRHARRVYVGGLPPLANEQAIATFFSQVMTAIGGNSAGPGDAVVNVYINHEKKFAFVEMRTVEEASNAMALDGIIFEGVAVRVRRPTDYNPTLAAALGPGQPSPNLNLAAVGLASGAIGGAEGPDRVFVGGLPYYFTETQIKELLESFGTLHGFDLVKDRDTGNSKGYGFCVYQDPAVTDIACAALNGLKMGDKTLTVRRATASGQSKTEQESILAQAQQHIAIQKMALQTSGMNTLGGGMSLFGETLAKVLCLTEAITADALADDEEYEEILEDMREECGKYGTLVNVVIPRPDQNGGETPGVGKVFLEYYDAVGCATAKNALSGRKFGGNTVNAFYYPEDKYFNKDYSA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHccccccccccEEEEEEEcccccEEEEEEccHHHHHHHHHccccEEccEEEEEccccccccccccccccccccccccHHHHccccccccccccccEEEEccccccccHHHHHHHHHHcccEEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccEEEEEEEccHHHHHHHHHHHcccCCcccEEEEEEccccccccccccc
**************************************************************************************************************************************************MLPFGATQLGAFPLMPVQVMTQQATRHARRVYVGGLPPLANEQAIATFFSQVMTAIGGNSAGPGDAVVNVYINHEKKFAFVEMRTVEEASNAMALDGIIFEGVAVRVRRPTDYNPTLA***********LNLAAVGLASGAIGGAEGPDRVFVGGLPYYFTETQIKELLESFGTLHGFDLVKDRDTGNSKGYGFCVYQDPAVTDIACAALNGLKMGDKTLTVRR********************HIAIQKMALQTSGMNTLGGGMSLFGETLAKVLCLTEAITADALADDEEYEEILEDMREECGKYGTLVNVVIPRPDQNGGETPGVGKVFLEYYDAVGCATAKNALSGRKFGGNTVNAFYYPEDKYFNK*Y**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGRDIRYDAVGEGSRHKSSWVSGRSRTGERGRDRHHRDFKSGGDDRRRDKNYKYDREGIRDHDRTDRHRDYNRDKERRHRHRSRSHSSDRFRNRSKSLSPSRSPSKSKRRSGFDMAPPAAAMLPGAAVPGQLPGVPSAVPEMAQNMLPFGATQLGAFPLMPVQVMTQQATRHARRVYVGGLPPLANEQAIATFFSQVMTAIGGNSAGPGDAVVNVYINHEKKFAFVEMRTVEEASNAMALDGIIFEGVAVRVRRPTDYNPTLAAALGPGQPSPNLNLAAVGLASGAIGGAEGPDRVFVGGLPYYFTETQIKELLESFGTLHGFDLVKDRDTGNSKGYGFCVYQDPAVTDIACAALNGLKMGDKTLTVRRATASGQSKTEQESILAQAQQHIAIQKMALQTSGMNTLGGGMSLFGETLAKVLCLTEAITADALADDEEYEEILEDMREECGKYGTLVNVVIPRPDQNGGETPGVGKVFLEYYDAVGCATAKNALSGRKFGGNTVNAFYYPEDKYFNKDYSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor U2af large subunit B Necessary for the splicing of pre-mRNA.probableQ2QZL4
Splicing factor U2af large subunit B Necessary for the splicing of pre-mRNA.probableQ8L716

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PGW, chain S
Confidence level:very confident
Coverage over the Query: 292-374
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain S
Confidence level:very confident
Coverage over the Query: 444-513
View the alignment between query and template
View the model in PyMOL
Template: 2G4B, chain A
Confidence level:very confident
Coverage over the Query: 173-262,292-372
View the alignment between query and template
View the model in PyMOL
Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 174-376
View the alignment between query and template
View the model in PyMOL
Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 170-199,213-257,293-379,416-514
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 292-384
View the alignment between query and template
View the model in PyMOL