Citrus Sinensis ID: 009974

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-

MVDPKVSNKSRFAQELISTILFTVAVGLVWLMGAAALQKYIGSLGGIGTSGVGSSSSYAPKELNKEVMPEKNVKTFKDVKGCDDAKQELVEVVEYLKNPSKFTRLGGKLPKGILLTGAPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGARRVRSLFQAAKKKAPCIIFIDEIDAVGSTRKQWEGHTKKTLHQLLVEMDGFEQNEGIILMAATNLPDILDPALTRPGRFDRHIVVPNPDVRGRQEILELYLQDKPLADDVDVKAIARGTPGFNGADLANLVNIAAIKAAVDGGEKLTATELEFAKDRILMGTERKTMFISEESKKLTAYHESGHAIVAFNTEGAHPIHKATIMPRGSALGMVTQLPSSDETSVSQKQLLARLDVCMGGRVAEELIFGRDHITTGASSDLHSATELAHYMVSNCGMSDAIGPVHIKDRPSSEMQSRIDAEVVKLLREAYDRVKALLKKHEKQLHALANALLEYETLSAEEIKRILLPYREGQLPEQQEELEEDLVLA

ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHcccccccccEEEcccccHHHHHHHHHHccccccEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHcccccccccEEEEEccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccHHHHHcc

********KSRFAQELISTILFTVAVGLVWLMGAAALQK*********************************VKTFKDVKGCDDAKQELVEVVEYLKNPSKFTRLGGKLPKGILLTGAPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGARRVRSLFQAAKKKAPCIIFIDEIDAVGSTRKQWEGHTKKTLHQLLVEMDGFEQNEGIILMAATNLPDILDPALTRPGRFDRHIVVPNPDVRGRQEILELYLQDKPLADDVDVKAIARGTPGFNGADLANLVNIAAIKAAVDGGEKLTATELEFAKDRILMGTERKTMFISEESKKLTAYHESGHAIVAFNTEGAHPIHKATIMPRGSALGMVTQLPSSDETSVSQKQLLARLDVCMGGRVAEELIFGRDHITTGASSDLHSATELAHYMVSNCGMSDAIGPVHIKDRPSSEMQSRIDAEVVKLLREAYDRVKALLKKHEKQLHALANALLEYETLSAEEIKRILLP********************

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVDPKVSNKSRFAQELISTILFTVAVGLVWLMGAAALQKYIGSLGGIGTSGVGSSSSYAPKELNKEVMPEKNVKTFKDVKGCDDAKQELVEVVEYLKNPSKFTRLGGKLPKGILLTGAPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGARRVRSLFQAAKKKAPCIIFIDEIDAVGSTRKQWEGHTKKTLHQLLVEMDGFEQNEGIILMAATNLPDILDPALTRPGRFDRHIVVPNPDVRGRQEILELYLQDKPLADDVDVKAIARGTPGFNGADLANLVNIAAIKAAVDGGEKLTATELEFAKDRILMGTERKTMFISEESKKLTAYHESGHAIVAFNTEGAHPIHKATIMPRGSALGMVTQLPSSDETSVSQKQLLARLDVCMGGRVAEELIFGRDHITTGASSDLHSATELAHYMVSNCGMSDAIGPVHIKDRPSSEMQSRIDAEVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSAEEIKRILLPYREGQLPEQQEELEEDLVLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial	Probable ATP-dependent zinc metallopeptidase. Involved in the assembly and/or stability of the complexes I and Involved in thermotolerance but not in high light stress resistance or in the assembly/stability of the complexes I and V of the mitochondrial oxidative phosphorylation system.	confident	Q9FGM0
ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial	Probable ATP-dependent zinc metallopeptidase.	probable	A2ZVG7
ATP-dependent zinc metalloprotease FtsH	Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins.	probable	D1BLD0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LV7, chain A
Confidence level:very confident
Coverage over the Query: 69-317
View the alignment between query and template
View the model in PyMOL

Template: 2CE7, chain A
Confidence level:very confident
Coverage over the Query: 71-358,375-501
View the alignment between query and template
View the model in PyMOL