Citrus Sinensis ID: 010007
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 520 | 2.2.26 [Sep-21-2011] | |||||||
| D3YYI7 | 515 | Probable E3 ubiquitin-pro | yes | no | 0.336 | 0.339 | 0.286 | 1e-16 | |
| Q9SKC4 | 514 | Probable E3 ubiquitin-pro | no | no | 0.492 | 0.498 | 0.266 | 2e-15 | |
| Q9SKC3 | 543 | Probable E3 ubiquitin-pro | no | no | 0.411 | 0.394 | 0.260 | 2e-14 | |
| Q4KLT0 | 282 | Probable E3 ubiquitin-pro | N/A | no | 0.357 | 0.659 | 0.280 | 1e-13 | |
| P0CE10 | 1787 | Putative uncharacterized | no | no | 0.323 | 0.094 | 0.255 | 8e-13 | |
| Q9P3U4 | 504 | Uncharacterized RING fing | yes | no | 0.467 | 0.482 | 0.272 | 2e-12 | |
| O76924 | 509 | Protein ariadne-2 OS=Dros | yes | no | 0.469 | 0.479 | 0.226 | 2e-12 | |
| Q6T486 | 520 | Probable E3 ubiquitin-pro | no | no | 0.421 | 0.421 | 0.231 | 2e-11 | |
| Q8TC41 | 275 | Probable E3 ubiquitin-pro | yes | no | 0.278 | 0.527 | 0.287 | 2e-11 | |
| P36113 | 551 | RING finger protein YKR01 | yes | no | 0.432 | 0.408 | 0.266 | 2e-11 |
| >sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 | Back alignment and function desciption |
|---|
Score = 88.2 bits (217), Expect = 1e-16, Method: Compositional matrix adjust.
Identities = 64/223 (28%), Positives = 90/223 (40%), Gaps = 48/223 (21%)
Query: 207 CSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKS 266
C +C EDKP + C C C++ Y+ +VQ QV I+CP C
Sbjct: 236 CRVCLEDKPIKPLPC--CKKAVCEECLKIYLSSQVQLGQVEIKCPVTEC----------- 282
Query: 267 FLPLSSYESLETALAEANILHSDRIYC--------------PFPNCSVLLDPRECLSARA 312
+E LE N+ H D I P P C ++
Sbjct: 283 ------FEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPT 336
Query: 313 SSSSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQ--- 369
S S+S ++CP C+ C +C PWH ++C+EY+ GD L A
Sbjct: 337 PSRSESRYK-IQCPTCQLIWCFKCHSPWHEGVNCKEYKK--------GDKLLRHWASEIE 387
Query: 370 --NKRWRRCQQCRRMIELTHGCYHMTC-WCGHEFCYSCGAEYR 409
+ ++C +C+ I+ T GC HMTC C FCY CG YR
Sbjct: 388 HGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYR 430
|
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mus musculus (taxid: 10090) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P0CE10|Y4102_ARATH Putative uncharacterized protein At4g01020, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|Q9P3U4|YKX2_SCHPO Uncharacterized RING finger protein C328.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.02 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6T486|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|P36113|YKZ7_YEAST RING finger protein YKR017C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR017C PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 520 | ||||||
| 224136528 | 521 | predicted protein [Populus trichocarpa] | 0.998 | 0.996 | 0.814 | 0.0 | |
| 225465698 | 525 | PREDICTED: uncharacterized protein LOC10 | 0.998 | 0.988 | 0.813 | 0.0 | |
| 224115510 | 501 | predicted protein [Populus trichocarpa] | 0.961 | 0.998 | 0.826 | 0.0 | |
| 255580832 | 517 | zinc finger protein, putative [Ricinus c | 0.992 | 0.998 | 0.779 | 0.0 | |
| 356532399 | 511 | PREDICTED: uncharacterized RING finger p | 0.963 | 0.980 | 0.734 | 0.0 | |
| 296085331 | 463 | unnamed protein product [Vitis vinifera] | 0.884 | 0.993 | 0.838 | 0.0 | |
| 449455425 | 515 | PREDICTED: uncharacterized protein LOC10 | 0.955 | 0.965 | 0.764 | 0.0 | |
| 356558029 | 514 | PREDICTED: uncharacterized protein LOC10 | 0.963 | 0.974 | 0.742 | 0.0 | |
| 357448361 | 520 | E3 ubiquitin-protein ligase RNF216 [Medi | 0.898 | 0.898 | 0.743 | 0.0 | |
| 297800082 | 532 | zinc finger family protein [Arabidopsis | 0.948 | 0.926 | 0.671 | 0.0 |
| >gi|224136528|ref|XP_002322352.1| predicted protein [Populus trichocarpa] gi|222869348|gb|EEF06479.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 839 bits (2167), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 425/522 (81%), Positives = 466/522 (89%), Gaps = 3/522 (0%)
Query: 1 MEDQDIVVDESSVKIVR-EVRLEEDEEEFRSCCEDDEVWKETEDVAVKEVVKEDLDEFSV 59
ME Q D SS +VR E++LEEDEE+FRSCCED+EVWKE ED+ VKE KEDLDEFSV
Sbjct: 1 MEGQVAFSDGSSASLVRGEMKLEEDEEDFRSCCEDEEVWKEIEDI-VKEEPKEDLDEFSV 59
Query: 60 KMFFKGMSITEVGESSSGFSGIGVVMERSFNIPIMQVQKKLDFFVEESVADYLALMDGLI 119
KMFFKGMS+ E G S+SGFSGIGVVMER+ +P++QVQKKLDF+V+ESVADYLALMDGL
Sbjct: 60 KMFFKGMSVAEDGGSASGFSGIGVVMERTEYVPVIQVQKKLDFYVDESVADYLALMDGLA 119
Query: 120 TAVQNKIRCVYAFTDSELLYDQITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIE 179
A+QN IR VYAFTDSELLYDQIT EEKL++PLL+ALRQRILE+ SNLEAFVLKL P +
Sbjct: 120 EAMQNNIRRVYAFTDSELLYDQITNEEKLEVPLLIALRQRILEHASNLEAFVLKLSPCCD 179
Query: 180 LERPLRLAQIAVGIVSSPSQGDKSPENCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDG 239
LERPL LAQ+AVG+VS PS G KS +NCSICCEDK PMMITMKCSHKFCSHCM+TY+DG
Sbjct: 180 LERPLHLAQVAVGVVSFPSNGSKSHDNCSICCEDKMSPMMITMKCSHKFCSHCMKTYVDG 239
Query: 240 KVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCS 299
KVQSSQVPI CPQL CKY IS EC+SFLPL+SYESLE ALAEA+I HSDRIYCP+PNCS
Sbjct: 240 KVQSSQVPIICPQLGCKYCISINECRSFLPLTSYESLENALAEADIHHSDRIYCPYPNCS 299
Query: 300 VLLDPRECLSARASSSSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDA 359
VLLD RECLSAR SSSS+SDN+C+ECPVC RFICVECGVPWHSS+ CEEYQNLPLEERDA
Sbjct: 300 VLLDHRECLSARVSSSSESDNTCIECPVCRRFICVECGVPWHSSMRCEEYQNLPLEERDA 359
Query: 360 GDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAF 419
DITLH LAQNKRWRRCQQCRRMIEL+ GC HMTCWCGHEFCYSCGAEYR+GQQTCQCAF
Sbjct: 360 ADITLHLLAQNKRWRRCQQCRRMIELSQGCSHMTCWCGHEFCYSCGAEYRNGQQTCQCAF 419
Query: 420 WDEDNSEEL-TQSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAGGFSLSDHH 478
WDE+NSE+L TQS ESEQ AWET+NSLPM+MDAYS+QERSQLALIQRFLAGGFSLSDHH
Sbjct: 420 WDEENSEDLVTQSAQESEQWAWETYNSLPMLMDAYSEQERSQLALIQRFLAGGFSLSDHH 479
Query: 479 PYQSPPRCTDSYGDAMKDLHQLPWLERFVSVISDTYYEDYMQ 520
PYQSPP CTDSY DAMKDLHQLPWLERFVSVISD YYEDY+Q
Sbjct: 480 PYQSPPSCTDSYVDAMKDLHQLPWLERFVSVISDNYYEDYIQ 521
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225465698|ref|XP_002273428.1| PREDICTED: uncharacterized protein LOC100263135 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224115510|ref|XP_002332152.1| predicted protein [Populus trichocarpa] gi|222875202|gb|EEF12333.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255580832|ref|XP_002531236.1| zinc finger protein, putative [Ricinus communis] gi|223529173|gb|EEF31150.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356532399|ref|XP_003534760.1| PREDICTED: uncharacterized RING finger protein C328.02-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296085331|emb|CBI29063.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449455425|ref|XP_004145453.1| PREDICTED: uncharacterized protein LOC101221315 [Cucumis sativus] gi|449525776|ref|XP_004169892.1| PREDICTED: uncharacterized protein LOC101229267 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356558029|ref|XP_003547311.1| PREDICTED: uncharacterized protein LOC100783040 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357448361|ref|XP_003594456.1| E3 ubiquitin-protein ligase RNF216 [Medicago truncatula] gi|355483504|gb|AES64707.1| E3 ubiquitin-protein ligase RNF216 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297800082|ref|XP_002867925.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297313761|gb|EFH44184.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 520 | ||||||
| TAIR|locus:2133935 | 532 | AT4G19670 [Arabidopsis thalian | 0.880 | 0.860 | 0.662 | 1.6e-173 | |
| TAIR|locus:2143995 | 655 | AT5G60250 [Arabidopsis thalian | 0.690 | 0.548 | 0.303 | 6.2e-46 | |
| TAIR|locus:2040065 | 373 | AT2G25360 [Arabidopsis thalian | 0.553 | 0.772 | 0.353 | 7.1e-45 | |
| TAIR|locus:2040025 | 603 | AT2G25370 [Arabidopsis thalian | 0.644 | 0.555 | 0.319 | 8.1e-44 | |
| TAIR|locus:2085672 | 408 | AT3G45580 [Arabidopsis thalian | 0.653 | 0.833 | 0.312 | 1.9e-42 | |
| TAIR|locus:2151689 | 444 | AT5G37560 [Arabidopsis thalian | 0.675 | 0.790 | 0.304 | 2.8e-41 | |
| TAIR|locus:2085622 | 222 | AT3G45470 [Arabidopsis thalian | 0.386 | 0.905 | 0.384 | 4.8e-39 | |
| TAIR|locus:2084116 | 320 | AT3G53690 [Arabidopsis thalian | 0.386 | 0.628 | 0.360 | 3.4e-38 | |
| TAIR|locus:2057401 | 398 | AT2G26130 [Arabidopsis thalian | 0.642 | 0.839 | 0.298 | 1e-36 | |
| TAIR|locus:2085612 | 348 | AT3G45540 [Arabidopsis thalian | 0.505 | 0.755 | 0.332 | 3.5e-36 |
| TAIR|locus:2133935 AT4G19670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1686 (598.6 bits), Expect = 1.6e-173, P = 1.6e-173
Identities = 316/477 (66%), Positives = 383/477 (80%)
Query: 57 FSVKMFFKGMSITEVGESSSGFSGIGVVMERSFNIPIMQVQKKLDFFVEESVADYLALMD 116
FSVKM FKG+SI E G+ SG+SGIGVV+ERS ++ ++QVQKKLDF+VEESVA+YLALMD
Sbjct: 57 FSVKMVFKGVSIFERGDLGSGYSGIGVVLERSGDLELIQVQKKLDFYVEESVANYLALMD 116
Query: 117 GLITAVQNKIRCVYAFTDSELLYDQITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVP 176
GL A+QN + V A TDSELLY+QITREE+L+IPLLVALR+R+LE TSNL FVLKL P
Sbjct: 117 GLEVALQNNLSSVVAVTDSELLYNQITREEQLEIPLLVALRERVLEKTSNLNGFVLKLAP 176
Query: 177 SIELERPLRLAQIAVGIVSSPSQGDKSPENCSICCEDKPYPMMITMKCSHKFCSHCMRTY 236
+L+ L LAQ+AVGIVSS GDK ENCSICCED+ MM+++KC+HKFCSHCM+TY
Sbjct: 177 FCDLDEALSLAQVAVGIVSSNLDGDKPIENCSICCEDRQSEMMLSLKCTHKFCSHCMKTY 236
Query: 237 IDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANIL--HSDRIYCP 294
++GKV++S+VPIRCPQ++CK+++S ECKSFLP+++++S E EAN+ ++ +IYCP
Sbjct: 237 VEGKVKTSEVPIRCPQVQCKHYLSAAECKSFLPVTTFKSFE----EANVCSKNNGKIYCP 292
Query: 295 FPNCSVLLDPRECLXXXXXXXXXXXXX----CVECPVCERFICVECGVPWHSSLSCEEYQ 350
+PNCS LLDP+ECL CVECPVCERF+CV+CGVPWH+S+SCEE+Q
Sbjct: 293 YPNCSFLLDPQECLSSGRASSSSSTQSENSCCVECPVCERFVCVDCGVPWHASMSCEEFQ 352
Query: 351 NLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRD 410
LP++ER DITLHRLA+ KRWRRCQQCR MIEL GC HMTC CGHEFCYSCGAEYR+
Sbjct: 353 ILPVDERYPDDITLHRLARYKRWRRCQQCRIMIELAQGCNHMTCRCGHEFCYSCGAEYRE 412
Query: 411 GQQTCQCAFWDEDNSEELT----QSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQR 466
GQQTC CAFWD+D E+ ++ E EQ W+TFNS+P +MDAYS+QERSQLALIQR
Sbjct: 413 GQQTCTCAFWDDDEEEQENAVEENTIQEVEQWPWDTFNSIPTVMDAYSEQERSQLALIQR 472
Query: 467 FLAGG-FSLSDHHP-YQSPPR-CTDS-YGDA-MKDLHQLPWLERFVSVISDTYYEDY 518
FLAGG FSLSDHH YQSPP CT+S Y +A MKDLHQLPWLERFVSVISD YYE+Y
Sbjct: 473 FLAGGGFSLSDHHTTYQSPPPPCTESSYVEAAMKDLHQLPWLERFVSVISDDYYEEY 529
|
|
| TAIR|locus:2143995 AT5G60250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040065 AT2G25360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040025 AT2G25370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085672 AT3G45580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151689 AT5G37560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085622 AT3G45470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057401 AT2G26130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085612 AT3G45540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 520 | |||
| cd09279 | 128 | cd09279, RNase_HI_archaeal_like, RNAse HI family t | 2e-08 | |
| smart00647 | 64 | smart00647, IBR, In Between Ring fingers | 1e-07 | |
| pfam01485 | 63 | pfam01485, IBR, IBR domain | 2e-05 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 0.004 |
| >gnl|CDD|187703 cd09279, RNase_HI_archaeal_like, RNAse HI family that includes Archaeal RNase HI | Back alignment and domain information |
|---|
Score = 52.5 bits (127), Expect = 2e-08
Identities = 28/112 (25%), Positives = 52/112 (46%), Gaps = 1/112 (0%)
Query: 79 SGIGVVMERSFNIPIMQVQKKLDFFVEESVADYLALMDGLITAVQNKIRCVYAFTDSELL 138
+G G+V++ +++ L F + A+Y AL+ GL A++ I+ + + DS+L+
Sbjct: 16 AGAGIVIKSPDGE-VLEQSIPLGFPATNNEAEYEALIAGLELALELGIKKLEIYGDSQLV 74
Query: 139 YDQITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIA 190
+QI E ++ L + E E +K +P E + LA A
Sbjct: 75 VNQIQGEYEVKNERLAPYLEEARELLKKFEEVEIKWIPREENKEADALANQA 126
|
Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, Type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD) residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Most archaeal genomes contain only type 2 RNase H (RNase HII); however, a few contain RNase HI as well. Although archaeal RNase HI sequences conserve the DEDD active-site motif, they lack other common features important for catalytic function, such as the basic protrusion region. Archaeal RNase HI homologs are more closely related to retroviral RNase HI than bacterial and eukaryotic type I RNase H in enzymatic properties. Length = 128 |
| >gnl|CDD|214763 smart00647, IBR, In Between Ring fingers | Back alignment and domain information |
|---|
| >gnl|CDD|216524 pfam01485, IBR, IBR domain | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 520 | |||
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.98 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.94 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 99.9 | |
| PRK07708 | 219 | hypothetical protein; Validated | 99.81 | |
| PRK13907 | 128 | rnhA ribonuclease H; Provisional | 99.79 | |
| COG0328 | 154 | RnhA Ribonuclease HI [DNA replication, recombinati | 99.76 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 99.74 | |
| PRK08719 | 147 | ribonuclease H; Reviewed | 99.56 | |
| PRK06548 | 161 | ribonuclease H; Provisional | 99.43 | |
| cd06222 | 130 | RnaseH RNase H (RNase HI) is an endonuclease that | 99.42 | |
| PRK00203 | 150 | rnhA ribonuclease H; Reviewed | 99.38 | |
| PF00075 | 132 | RNase_H: RNase H; InterPro: IPR002156 The RNase H | 99.11 | |
| PF13456 | 87 | RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EH | 99.0 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 98.91 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 98.82 | |
| KOG3752 | 371 | consensus Ribonuclease H [Replication, recombinati | 98.68 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.34 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 98.25 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.17 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 98.14 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.12 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.08 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.05 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.02 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.81 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.78 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 97.67 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.62 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.48 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.47 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.45 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.43 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.43 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.34 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.31 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 96.93 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 96.89 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 96.84 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 96.74 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.72 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.59 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.55 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.36 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.14 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 96.13 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 95.56 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 95.52 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 94.92 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 94.59 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.42 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 94.29 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.16 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 93.93 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 93.82 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.06 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 92.86 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.53 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 91.49 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 91.44 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 91.18 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 90.94 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 90.47 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.33 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.25 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 90.04 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 89.69 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 89.53 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 89.45 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 89.17 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.15 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.15 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.07 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 88.49 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.32 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 87.99 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.56 | |
| PHA00626 | 59 | hypothetical protein | 87.39 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 87.29 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 87.25 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 85.2 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 85.12 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 84.54 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.98 | |
| PF14952 | 44 | zf-tcix: Putative treble-clef, zinc-finger, Zn-bin | 83.91 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 83.55 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 82.56 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 82.13 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 81.69 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 81.61 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 81.37 | |
| PRK05654 | 292 | acetyl-CoA carboxylase subunit beta; Validated | 80.21 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 80.16 |
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-51 Score=426.08 Aligned_cols=341 Identities=34% Similarity=0.670 Sum_probs=281.5
Q ss_pred EEEeecccccccCCCCCcccceEEEEeec-CCCceEEEeecccc--cchhhHHHHHHHHHHHHHHHHcCcceeeeecccH
Q 010007 60 KMFFKGMSITEVGESSSGFSGIGVVMERS-FNIPIMQVQKKLDF--FVEESVADYLALMDGLITAVQNKIRCVYAFTDSE 136 (520)
Q Consensus 60 ~~~fdG~~~~~~~~~n~~~ag~g~~i~~~-~~~~~~~~~~~~~~--~~tnn~AE~~ALi~~l~~a~~~~i~~v~i~~Dse 136 (520)
++||+|++++|.++. .+.+|+||+|+|. ++++.+....+... .+|...||++||+.+|.+|+++++..+.++.|+.
T Consensus 1 ~l~~k~lv~~e~~~~-~~~~g~~vai~d~~d~~~~f~~k~~~~~~~~~~~~~ae~~al~~~l~ea~~~~~~~~~~~~d~~ 79 (384)
T KOG1812|consen 1 RLYFKGLVSEESIND-ILLAGFGVAICDEHDDDLLFQMKASDHDSDSITPLEAELMALKRGLTEALELGLNHIVIYCDDE 79 (384)
T ss_pred CCccccchhhhhhhh-hhcccCceeeeccccHHHHHHhhcCcccccccchhhHHHHHHhhccHHHHhhccccceEecccH
Confidence 479999999776422 5789999999997 45554444444433 2688999999999999999999999999999999
Q ss_pred HHHHHhhhhhhcchh-HHHHHHHHHHHHhhhhhhHHhhccccc-ccccHHHHHHHhhccCCCCCCCCCcccccccccccc
Q 010007 137 LLYDQITREEKLDIP-LLVALRQRILEYTSNLEAFVLKLVPSI-ELERPLRLAQIAVGIVSSPSQGDKSPENCSICCEDK 214 (520)
Q Consensus 137 lv~~ql~g~~~~~~~-~L~~l~~ril~l~~~f~~~~l~lvpr~-~~~~a~klA~~Ai~~~~~~~~~~~~~~~C~IC~e~~ 214 (520)
++++.+.+....... .+..+..++....+.|......++++. +.+.+.++|.+++.. .........+|.||+.+.
T Consensus 80 ~~~~~v~~~~~~~~~~~~~~l~~~v~~~r~~l~~~~~i~~~~~~d~~~~~~lA~e~i~s---~~~~~~~~~~C~iC~~e~ 156 (384)
T KOG1812|consen 80 LIYESVAGREKPEQHRKIVLLVELVQRIREQLTSSEPILVPKNADIKFAYKLAREAIVS---QLPSKLPKEECGICFVED 156 (384)
T ss_pred HHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHhhcccceecccchhhHHHHHHHHHhhcc---ccccccccccCccCcccc
Confidence 999988888777665 677777888777777777777777664 778899999999876 223345678999999555
Q ss_pred CCC-Ceeec-cCCCcccHHHHHHHHHHhhhCCCCccccCCCCcCcccchHHHhhcCCcccHHHHHHHHHHHhhcCCCcee
Q 010007 215 PYP-MMITM-KCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIY 292 (520)
Q Consensus 215 ~~~-~~~~l-~CgH~fC~~Cl~~~i~~~i~~~~~~i~CP~~~C~~~l~~~~i~~~L~~~~~e~~~~~~~e~~~~~~~~~~ 292 (520)
+.. .++.. .|+|.||.+|+++|++++ ..+...|+||..+|+..++.+.+..+|++++.++|++++.+..++..+.+|
T Consensus 157 ~~~~~~f~~~~C~H~fC~~C~k~~iev~-~~~~~~~~C~~~~C~~~l~~~~c~~llt~kl~e~~e~~~~e~~i~~~~~~y 235 (384)
T KOG1812|consen 157 PEAEDMFSVLKCGHRFCKDCVKQHIEVK-LLSGTVIRCPHDGCESRLTLESCRKLLTPKLREMWEQRLKEEVIPSLDRVY 235 (384)
T ss_pred ccHhhhHHHhcccchhhhHHhHHHhhhh-hccCCCccCCCCCCCccCCHHHHhhhcCHHHHHHHHHHHHHHhhhhhhccc
Confidence 544 55554 899999999999999999 445567899999999999999999999999999999999999998777779
Q ss_pred ccCCCCCeeecCcccccccccCCCCCCCCceeCCCCCcceeccCCCccCCCCCchhhhcCchhhcCchHHHHHHHHhccC
Q 010007 293 CPFPNCSVLLDPRECLSARASSSSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKR 372 (520)
Q Consensus 293 CP~p~C~~~~~~~~~~~~~~~~~~~~~~~~~~Cp~C~~~fC~~C~~~wH~~~tC~e~~~~~~~~~~~~~~~l~~l~~~~~ 372 (520)
||+|+|+.++...+..+ ........|+.|+..||..|+.+||.+.+|++|+++.. +...++..++.++ +.
T Consensus 236 cp~~~C~~l~~~~el~~-------~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~eykk~~~-~~~~d~~~~~~la--~~ 305 (384)
T KOG1812|consen 236 CPYPRCSSLMSKTELSS-------EVKSKRRPCVKCHELFCVKCKVPWHANLSCEEYKKLNP-EEYVDDITLKYLA--KR 305 (384)
T ss_pred CCCCCchHhhhhhhhcc-------chhhcccccccCCCceeecCCCcCCCCCCHHHHHHhCC-cccccHHHHHHHH--Hh
Confidence 99999999987766431 11123367999999999999999999999999999875 3344567777888 78
Q ss_pred CccCccccceeeecCCcceEEecccccccccccccccCCCCcc
Q 010007 373 WRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTC 415 (520)
Q Consensus 373 ~k~CP~C~~~IeK~~GCnhMtC~Cg~~FCy~C~~~~~~~~~~c 415 (520)
||+||+|+.+|+|++|||||||+|||+|||.|+.+|..+...|
T Consensus 306 wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~~~~~~~~~~~ 348 (384)
T KOG1812|consen 306 WRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCGGDWKTHNGEC 348 (384)
T ss_pred cCcCcccceeeeecCCcceEEeeccccchhhcCcchhhCCccc
Confidence 9999999999999999999999999999999999998766544
|
|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07708 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13907 rnhA ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08719 ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PRK06548 ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner | Back alignment and domain information |
|---|
| >PRK00203 rnhA ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site | Back alignment and domain information |
|---|
| >PF13456 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3752 consensus Ribonuclease H [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14952 zf-tcix: Putative treble-clef, zinc-finger, Zn-binding | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05654 acetyl-CoA carboxylase subunit beta; Validated | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
Score = 61.0 bits (148), Expect = 6e-12
Identities = 17/90 (18%), Positives = 34/90 (37%), Gaps = 4/90 (4%)
Query: 200 GDKSPENCSICCEDKPYPMMITMK-CSHKFCSHCMRTYIDGKVQSSQV-PIRCPQLRC-- 255
G C +C + P M T+ C FC+ C++ Y++ ++ I CP C
Sbjct: 1 GSSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPK 60
Query: 256 KYFISTVECKSFLPLSSYESLETALAEANI 285
+ + E + + + + E +
Sbjct: 61 QGHLQENEIECMVAAEIMQRYKKLQFERSG 90
|
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} Length = 141 | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A Length = 149 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 520 | |||
| 3hst_B | 141 | Protein RV2228C/MT2287; ribonuclease H1, RV2228C N | 99.84 | |
| 3u3g_D | 140 | Ribonuclease H, RNAse H1; hydrolase, cleave the RN | 99.84 | |
| 2ehg_A | 149 | Ribonuclease HI; RNAse HI, hyperthermophilic archa | 99.79 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 99.68 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 99.64 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 99.63 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 99.62 | |
| 1zbf_A | 142 | Ribonuclease H-related protein; RNAse H, RNA/DNA h | 99.6 | |
| 4htu_A | 134 | Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, | 99.58 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.58 | |
| 2lsn_A | 165 | Reverse transcriptase; RNAse H, viral protein; NMR | 99.57 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 99.56 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 99.56 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 99.54 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 99.53 | |
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 99.53 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 99.26 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 99.25 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 99.09 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 98.99 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.72 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.68 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.44 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.38 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.37 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.37 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.36 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.36 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.33 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.31 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.31 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.31 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.29 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.25 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.25 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.21 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.19 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.18 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.14 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.14 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.14 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.13 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.13 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.13 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.12 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.12 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.12 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.05 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.05 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.03 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.01 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.99 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.97 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.96 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 97.96 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 97.95 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 97.9 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.89 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.86 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.85 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.85 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 97.82 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 97.81 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.79 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.71 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 97.71 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.65 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 97.57 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.56 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.55 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.52 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 97.47 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 97.42 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.37 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.31 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 97.29 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.29 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 97.27 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.26 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.22 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 97.17 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 97.06 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 97.0 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 96.9 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 96.51 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 95.95 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 95.75 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 94.94 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 94.86 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 94.41 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 93.5 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 93.3 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 92.8 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 90.47 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 85.7 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 83.75 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 82.07 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 81.43 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 80.67 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 80.57 |
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Probab=99.84 E-value=6.1e-21 Score=170.38 Aligned_cols=132 Identities=23% Similarity=0.255 Sum_probs=120.0
Q ss_pred eEEEEeecccccccCCCCCcccceEEEEeecC-CCceEEEeecccccchhhHHHHHHHHHHHHHHHHcCcceeeeecccH
Q 010007 58 SVKMFFKGMSITEVGESSSGFSGIGVVMERSF-NIPIMQVQKKLDFFVEESVADYLALMDGLITAVQNKIRCVYAFTDSE 136 (520)
Q Consensus 58 ~~~~~fdG~~~~~~~~~n~~~ag~g~~i~~~~-~~~~~~~~~~~~~~~tnn~AE~~ALi~~l~~a~~~~i~~v~i~~Dse 136 (520)
.++|||||+++ + |||++|+|++|.+++ |..+...+..++.. |||.||+.|++.||..+..++..+|.|++||+
T Consensus 3 ~~~iy~DGs~~---~--~~g~~g~G~v~~~~~~~~~~~~~~~~~~~~-tn~~aEl~A~~~aL~~a~~~~~~~v~i~tDS~ 76 (141)
T 3hst_B 3 KVVIEADGGSR---G--NPGPAGYGAVVWTADHSTVLAESKQAIGRA-TNNVAEYRGLIAGLDDAVKLGATEAAVLMDSK 76 (141)
T ss_dssp EEEEEEEEEES---S--SSEEEEEEEEEEETTSCSEEEEEEEEEEEE-CHHHHHHHHHHHHHHHHHHHTCSEEEEEESCH
T ss_pred EEEEEEecCCC---C--CCCCcEEEEEEEeCCCCcEEEeeeccCCCC-chHHHHHHHHHHHHHHHHHCCCceEEEEeChH
Confidence 58999999999 7 899999999999986 56656777777644 99999999999999999999999999999999
Q ss_pred HHHHHhhhhhhcchhHHHHHHHHHHHHhhhhhhHHhhcccccccccHHHHHHHhhccCC
Q 010007 137 LLYDQITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIVS 195 (520)
Q Consensus 137 lv~~ql~g~~~~~~~~L~~l~~ril~l~~~f~~~~l~lvpr~~~~~a~klA~~Ai~~~~ 195 (520)
++++++++.|+++++.+..+.+++..+.++|..+.+.||++..|+.||+||+.++....
T Consensus 77 ~vv~~i~~~~~~~~~~l~~~~~~i~~l~~~~~~v~~~~V~~~~N~~AD~LA~~a~~~~~ 135 (141)
T 3hst_B 77 LVVEQMSGRWKVKHPDLLKLYVQAQALASQFRRINYEWVPRARNTYADRLANDAMDAAA 135 (141)
T ss_dssp HHHHHHTTSSCCCSHHHHHHHHHHHHHHTTSSEEEEEECCGGGCHHHHHHHHHHHHHHH
T ss_pred HHHHHHhCCcccCCHHHHHHHHHHHHHHhcCCeEEEEEcCCcccHHHHHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999999999999999999876543
|
| >3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A | Back alignment and structure |
|---|
| >1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* | Back alignment and structure |
|---|
| >4htu_A Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, W-C base PAIR, wobble base PAIR, D helix; HET: DNA UCL; 1.49A {Bacillus halodurans} PDB: 3d0p_A* 4hue_A* 4huf_A* 4hug_A* 1zbf_A 1zbi_A 2g8u_A 3uld_A* 3ey1_A* 3twh_A* 2g8f_A 2g8v_A 2g8w_A 2g8i_A 2g8h_A 2g8k_A 3i8d_A* 2r7y_A* 1zbl_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A | Back alignment and structure |
|---|
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 520 | ||||
| d2ct7a1 | 73 | g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H | 1e-12 | |
| d1wd2a_ | 60 | g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho | 1e-10 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 7e-08 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 0.002 |
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: IBR domain domain: Ring finger protein 31 species: Human (Homo sapiens) [TaxId: 9606]
Score = 60.8 bits (147), Expect = 1e-12
Identities = 12/67 (17%), Positives = 22/67 (32%), Gaps = 1/67 (1%)
Query: 361 DITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTC-WCGHEFCYSCGAEYRDGQQTCQCAF 419
+T L ++ ++ C QC TC C FC C ++ + + C
Sbjct: 6 KLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCED 65
Query: 420 WDEDNSE 426
+
Sbjct: 66 FQNWKRM 72
|
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 520 | |||
| d1wd2a_ | 60 | Ariadne-1 protein homolog {Human (Homo sapiens) [T | 99.67 | |
| d1zbfa1 | 132 | BH0863-like Ribonuclease H {Bacillus halodurans [T | 99.58 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 99.52 | |
| d1s1ta1 | 110 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.43 | |
| d1rila_ | 147 | RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 | 99.37 | |
| d1mu2a1 | 126 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.35 | |
| d1jl1a_ | 152 | RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | 99.32 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 99.14 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 98.73 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.3 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.26 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.25 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.16 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.07 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.01 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 97.99 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 97.99 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 97.98 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 97.9 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.9 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.86 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.8 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.48 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.02 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 96.13 | |
| d1wd2a_ | 60 | Ariadne-1 protein homolog {Human (Homo sapiens) [T | 92.65 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 92.5 | |
| d1wfha_ | 64 | Zinc finger A20 and AN1 domains containing protein | 87.29 | |
| d1wffa_ | 85 | ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus | 87.23 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 84.18 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 84.14 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 84.12 | |
| d2akla2 | 38 | Hypothetical protein PA0128, N-terminal domain {Ps | 82.28 | |
| d2k4xa1 | 55 | Ribosomal protein S27ae {Thermoplasma acidophilum | 81.08 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 80.53 |
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Ariadne-1 protein homolog species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.67 E-value=4.3e-18 Score=126.19 Aligned_cols=52 Identities=31% Similarity=0.780 Sum_probs=45.7
Q ss_pred cCCccCccccceeeecCCcceEEec---ccccccccccccccCC-CCcccCCCCCC
Q 010007 371 KRWRRCQQCRRMIELTHGCYHMTCW---CGHEFCYSCGAEYRDG-QQTCQCAFWDE 422 (520)
Q Consensus 371 ~~~k~CP~C~~~IeK~~GCnhMtC~---Cg~~FCy~C~~~~~~~-~~~c~C~~~~~ 422 (520)
..+|+||+|+++|+|++|||||||+ ||++|||+|+++|..+ ...++|++|++
T Consensus 4 ~ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~~~~~~~~~C~~~~e 59 (60)
T d1wd2a_ 4 ANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNE 59 (60)
T ss_dssp CCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGTSSSSSCSCCC
T ss_pred hcCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccccCCCCCCCCcCCcc
Confidence 3469999999999999999999996 9999999999999764 34567999886
|
| >d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|