BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010087
         (518 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2VSQ|A Chain A, Structure Of Surfactin A Synthetase C (Srfa-C), A
            Nonribosomal Peptide Synthetase Termination Module
          Length = 1304

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 377  LMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLLGA 424
            L+Q LQ   P+TL GYS G  + F+  + L E      IV+R++++ +
Sbjct: 1104 LIQKLQPEGPLTLFGYSAGCSLAFEAAKKLEE---QGRIVQRIIMVDS 1148


>pdb|1JMK|C Chain C, Structural Basis For The Cyclization Of The Lipopeptide
           Antibiotic Surfactin By The Thioesterase Domain Srfte
 pdb|1JMK|O Chain O, Structural Basis For The Cyclization Of The Lipopeptide
           Antibiotic Surfactin By The Thioesterase Domain Srfte
          Length = 230

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 377 LMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNAGIVERVVLL 422
           L+Q LQ   P+TL GYS G  + F+  + L   E    IV+R++++
Sbjct: 63  LIQKLQPEGPLTLFGYSAGCSLAFEAAKKL---EGQGRIVQRIIMV 105


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.136    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,380,786
Number of Sequences: 62578
Number of extensions: 390158
Number of successful extensions: 959
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 955
Number of HSP's gapped (non-prelim): 5
length of query: 518
length of database: 14,973,337
effective HSP length: 103
effective length of query: 415
effective length of database: 8,527,803
effective search space: 3539038245
effective search space used: 3539038245
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)