Citrus Sinensis ID: 010098

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MDRKQQHIAIFTTASLPWLTGTAVNPLFRAAYLAKDGERRVTLVIPWLSLIHQKQVYPGNITFASPKEQEAYVRWWLEDRTGFTSTFDTRFYPGKFAADKKSILAVGDITEIIPDEEADIAVLEEPEHLTWFHHGKRWKAKFRFVVGIVHTNYLEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAELVGDVVTKRSKSPSRHLESESLNSKRIIEDAFGYLHYVASGFETSRRALGAIPGSLQPDEQLCKELGLVTELGKGHCHRPNGSWFGSVLVLVGSVIGVLFVKSVTLKLSVNARVGSNKHALLRLHLA
ccccccEEEEEEcccccccccccccHHHHHHHHHHccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHccccccccEEEEccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHccHHHHHccccCEEEEEEEECcccccccHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEECccccHHHHHHHHHHcccEEEECcccccHHHHHHcccEEEccccccccHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccHHHHHHcccccccccccccccccccccHHHHHHccEEEEEEEEEEEEEEEEEEEcccccHHHHHcccc
***KQQHIAIFTTASLPWLTGTAVNPLFRAAYLAKDGERRVTLVIPWLSLIHQKQVYPGNITFASPKEQEAYVRWWLEDRTGFTSTFDTRFYPGKFAADKKSILAVGDITEIIPDEEADIAVLEEPEHLTWFHHGKRWKAKFRFVVGIVHTNYLEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAELVGDVV*******************RIIEDAFGYLHYVASGFETSRRALGAIPGSLQPDEQLCKELGLVTELGKGHCHRPNGSWFGSVLVLVGSVIGVLFVKSVTLKLSVNARVGSNKHALLRLHLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRKQQHIAIFTTASLPWLTGTAVNPLFRAAYLAKDGERRVTLVIPWLSLIHQKQVYPGNITFASPKEQEAYVRWWLEDRTGFTSTFDTRFYPGKFAADKKSILAVGDITEIIPDEEADIAVLEEPEHLTWFHHGKRWKAKFRFVVGIVHTNYLEYVKREKNDRLQAFLLEFVNSWLARVHCHKVIRLSAATQEYPNSIVCNVHGVNPKFLEIGEKKMEQQQNGNKAFTKGAYYIGRMVWSKGYEELLGLLNIYHKELAGLEMDLYGNGEDFDQIQRAAKKLKLVVRVYPGRDHADPIFHDYKVFLNPSTTDVVCTATAEALAMGKIVVCANHPSNDFFKQFPNCRTYDGRNGFVEATLKALAEEPAQPTDAQTHQLSWESATERFLQVAELVGDVVTKRSKSPSRHLESESLNSKRIIEDAFGYLHYVASGFETSRRALGAIPGSLQPDEQLCKELGLVTELGKGHCHRPNGSWFGSVLVLVGSVIGVLFVKSVTLKLSVNARVGSNKHALLRLHLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Digalactosyldiacylglycerol synthase 2, chloroplastic Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes. Specific for alpha-glycosidic linkages.confidentQ8W1S1
Digalactosyldiacylglycerol synthase 2, chloroplastic Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes. Specific for alpha-glycosidic linkages.confidentQ6DW75
Digalactosyldiacylglycerol synthase 2, chloroplastic Involved in the synthesis of diacylglycerol galactolipids that are specifically found in thylakoid membranes. Specific for alpha-glycosidic linkages.probableQ6DW73

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.241Digalactosyldiacylglycerol synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JJM, chain A
Confidence level:very confident
Coverage over the Query: 7-65,81-394
View the alignment between query and template
View the model in PyMOL
Template: 1RZU, chain A
Confidence level:confident
Coverage over the Query: 6-394
View the alignment between query and template
View the model in PyMOL