BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010143
         (517 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Z67|A Chain A, Crystal Structure Of Archaeal O-phosphoseryl-trna(sec)
           Selenium Transferase (sepsecs)
 pdb|2Z67|B Chain B, Crystal Structure Of Archaeal O-phosphoseryl-trna(sec)
           Selenium Transferase (sepsecs)
 pdb|2Z67|C Chain C, Crystal Structure Of Archaeal O-phosphoseryl-trna(sec)
           Selenium Transferase (sepsecs)
 pdb|2Z67|D Chain D, Crystal Structure Of Archaeal O-phosphoseryl-trna(sec)
           Selenium Transferase (sepsecs)
          Length = 456

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 231 IDAKVPISSSVAPRTRPSNPSGRTYNLSHSSPLEQKKEDRDYGDAHLSEHS 281
           +D + PI+S ++  + P   + + YNL  + P   KK D  +G+ +L  ++
Sbjct: 378 LDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDH-FGNCYLGTYT 427


>pdb|1NKQ|A Chain A, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|B Chain B, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|C Chain C, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|D Chain D, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|E Chain E, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
 pdb|1NKQ|F Chain F, Crystal Structure Of Yeast Ynq8, A Fumarylacetoacetate
           Hydrolase Family Protein
          Length = 259

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 208 AERIRQVQQSSARQPSTYVLPTPIDAKVPISSSVAPRTRPSNPSGRTYNLSHSSP 262
           A  I+++  S+ +QP  ++ PT      P+SSS+   TRP+N +    N   ++P
Sbjct: 20  AAHIKELNNSTPKQPFFFLKPTS-SIVTPLSSSLVKTTRPANSTFNGLNEDGTNP 73


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.125    0.348 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,595,632
Number of Sequences: 62578
Number of extensions: 448060
Number of successful extensions: 670
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 668
Number of HSP's gapped (non-prelim): 10
length of query: 517
length of database: 14,973,337
effective HSP length: 103
effective length of query: 414
effective length of database: 8,527,803
effective search space: 3530510442
effective search space used: 3530510442
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)