Citrus Sinensis ID: 010184


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510------
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYMEYRYDPWQKQLFKASSQIFFSFQLLYAVQCIVSHDL
cccccccccccccccccccccccccccHHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHccccccEEEEcccccccccccccEEEEcEEccccccccccHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHcccEEEEEEEEEEEccccccccccccccCEECccHHHHHHcccccEEEEEEEEccccHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHcccEEEccccHHHHHHHHHHHccccccEEEEEEcccccccccccccEEEEEccccccHHHHHHHHHHHcccccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHcccEEEccccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHcccccccc
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLP*****ADLSYHRLDEQLALLGKVLSAGDDAVG*******A***ALHKARRIAG****MSGAQGMVYMEYRYDPWQKQLFKASSQIFFSFQLLYAVQCIVSHD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEEYDFRNDNVNPDLNMELKPHAQPRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVSAACRIKKSCLCLATNAVSVDQWAFQFKLWSTIQDDQICRFTSDSKERFRGNAGVVVTTYNMVAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPAHMFRKVISLTKSHCKLGLTATLVREDERITDLNFLIGPKLYEANWLDLVKGGFIANVQCAEVWCPMTKEFFSEYLKKENSKKKQALYVMNPNKFRACEFLIRFHEQQRGDKIIVFADNLFALTEYAMKLRKPMIYGATSHVERTKILQAFKCSRDLNTIFLSKVGDNSIDIPEANVIIQISSHAGSRRQEAQRLGRILRAKGKLEDRMAGGKEEYNAFFYSLVSTDTQEMFYSTKRQQFLIDQGYSFKVITSLPPPDSGADLSYHRLDEQLALLGKVLSAGDDAVGLEQLDEDADDIALHKARRIAGSMSAMSGAQGMVYMEYRYDPWQKQLFKASSQIFFSFQLLYAVQCIVSHDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA repair helicase XPB1 Putative ATP-dependent 3'-5' DNA helicase involved in nucleotide excision repair (NER) of DNA. May be involved in RNA transcription by RNA polymerase II. Acts by opening DNA around either the RNA transcription start site or the DNA damage (By similarity). Required during the early stages of development, including seed germination.confidentQ38861
DNA repair helicase XPB2 Putative ATP-dependent 3'-5' DNA helicase involved in nucleotide excision repair (NER) of DNA. May be involved in RNA transcription by RNA polymerase II. Acts by opening DNA around either the RNA transcription start site or the DNA damage.confidentQ9FUG4
TFIIH basal transcription factor complex helicase XPB subunit ATP-dependent 3'-5' DNA helicase, component of the core-TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage.probableQ1RMT1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.12DNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FWR, chain A
Confidence level:very confident
Coverage over the Query: 19-127,138-360,372-387
View the alignment between query and template
View the model in PyMOL
Template: 2OCA, chain A
Confidence level:very confident
Coverage over the Query: 23-361,372-409
View the alignment between query and template
View the model in PyMOL
Template: 4ERN, chain A
Confidence level:very confident
Coverage over the Query: 213-457
View the alignment between query and template
View the model in PyMOL