BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010223
(514 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q9Y7S6|AATR3_SCHPO Aromatic amino acid aminotransferase C569.07 OS=Schizosaccharomyces
pombe (strain 972 / ATCC 24843) GN=SPCC569.07 PE=3 SV=1
Length = 470
Score = 34.3 bits (77), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
Query: 66 LSFASSPPQPKR-PVPPLRLAFSLLSSWSPDFRRRAVVSFTL 106
LSFA P P + P+ L ++F ++SW D + A VS+ L
Sbjct: 39 LSFAGGEPNPSKFPIHKLSVSFPEVNSWEKDTNKDATVSYEL 80
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.325 0.136 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 181,326,002
Number of Sequences: 539616
Number of extensions: 7281848
Number of successful extensions: 23200
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 23196
Number of HSP's gapped (non-prelim): 9
length of query: 514
length of database: 191,569,459
effective HSP length: 122
effective length of query: 392
effective length of database: 125,736,307
effective search space: 49288632344
effective search space used: 49288632344
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)