BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010223
         (514 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9Y7S6|AATR3_SCHPO Aromatic amino acid aminotransferase C569.07 OS=Schizosaccharomyces
           pombe (strain 972 / ATCC 24843) GN=SPCC569.07 PE=3 SV=1
          Length = 470

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 66  LSFASSPPQPKR-PVPPLRLAFSLLSSWSPDFRRRAVVSFTL 106
           LSFA   P P + P+  L ++F  ++SW  D  + A VS+ L
Sbjct: 39  LSFAGGEPNPSKFPIHKLSVSFPEVNSWEKDTNKDATVSYEL 80


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.325    0.136    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 181,326,002
Number of Sequences: 539616
Number of extensions: 7281848
Number of successful extensions: 23200
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 23196
Number of HSP's gapped (non-prelim): 9
length of query: 514
length of database: 191,569,459
effective HSP length: 122
effective length of query: 392
effective length of database: 125,736,307
effective search space: 49288632344
effective search space used: 49288632344
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)