Citrus Sinensis ID: 010232


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MQTPVQACKSFTFTLLNSAPPLSTCSFVQNGNAKYPLQQSRKFHSFAASFRFLRSTHIVFCSQKDVFDDLSSAQFPENVENEGLEGNEELELLNKPNLVPISNGVASEVDKKSEKPDEEEALAPFLKFFKPRDSAEEVEEEGSEVGVSRESIDVDDKVGEDKVSVEYYEPKPGDFVIGVVVSGNENKLDVNVGADLLGTMLTKEVLPLYDKEMDFLLCDLKKDAEEFMVRGKMGIVKDDDAIAMSGGSGPGRPVVETGTVLFAEVLGRTLSGRPLLSTRRLFRKMAWHRVRQIKQLNEPIEVKFTEWNTGGLLTRIEGLRAFLPKAELLSRVNNFTELKEKVGRRMYVQITRINEDTNDLILSEREAWATLNLREGTLLEGTVKKIYPYGAQIRIGDSNRSGLLHISNMSRTRVTSVSDLLNEGERVKVLVVKSMFPDKISLSIADLESEPGLFVSDKERVFSEAEEMAKKYRQKLPAVSVSPKSESLPTDTPPFDSEASMCANWKWFRFEQDS
cccccccccccccccccccccccccccccccccccccccHcccccccccccccccEEEEEEccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccHHHHcccccccccccccccHHHcccccccccccccccccccccccccccccccccccEEEEEEEEECccEEEEEccccccccEEccccccccHHHHHHHHHHcccccccEEEEEEEEEEcccccEEccccccccccccccccEEEEEEEEEcccccEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEEEECcEEEEEEccEEEEEcccccccccccccccccccccEEEEEEEEEEcccccEEEEHHHHHHHHccccccEEEEEEEEECccCEEEEcccccccccEEEEccccccccccccccccccEEEEEEEEcccccEEEECccccccccccccccccccccEEEEEEEEEccccccEEccccccccccccccccccccCCccEEEEEEEccc
******ACKSFTFTLLNSAPPLSTCSFVQNGNAKYPLQQSRKFHSFAASFRFLRSTHIVFCSQKDVFDDL********************************************************************************************VSVEYYEPKPGDFVIGVVVSGNENKLDVNVGADLLGTMLTKEVLPLYDKEMDFLLCDLKKDAEEFMVRGKMGIVKDDDAIAMSGGSGPGRPVVETGTVLFAEVLGRTLSGRPLLSTRRLFRKMAWHRVRQIKQLNEPIEVKFTEWNTGGLLTRIEGLRAFLPKAELLSRVNNFTELKEKVGRRMYVQITRINEDTNDLILSEREAWATLNLREGTLLEGTVKKIYPYGAQIRIGDSNRSGLLHISNMSRTRVTSVSDLLNEGERVKVLVVKSMFPDKISLSIADLESEPGLFVSDKERVFSEAEEMAKKYRQKLPAVSVSPKSESLPTDTPPFDSEASMCANWKWFRFEQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTPVQACKSFTFTLLNSAPPLSTCSFVQNGNAKYPLQQSRKFHSFAASFRFLRSTHIVFCSQKDVFDDLSSAQFPENVENEGLEGNEELELLNKPNLVPISNGVASEVDKKSEKPDEEEALAPFLKFFKPRDSAEEVEEEGSEVGVSRESIDVDDKVGEDKVSVEYYEPKPGDFVIGVVVSGNENKLDVNVGADLLGTMLTKEVLPLYDKEMDFLLCDLKKDAEEFMVRGKMGIVKDDDAIAMSGGSGPGRPVVETGTVLFAEVLGRTLSGRPLLSTRRLFRKMAWHRVRQIKQLNEPIEVKFTEWNTGGLLTRIEGLRAFLPKAELLSRVNNFTELKEKVGRRMYVQITRINEDTNDLILSEREAWATLNLREGTLLEGTVKKIYPYGAQIRIGDSNRSGLLHISNMSRTRVTSVSDLLNEGERVKVLVVKSMFPDKISLSIADLESEPGLFxxxxxxxxxxxxxxxxxxxxxLPAVSVSPKSESLPTDTPPFDSEASMCANWKWFRFEQDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GO5, chain A
Confidence level:very confident
Coverage over the Query: 171-206,253-282,294-452,466-480,491-513
View the alignment between query and template
View the model in PyMOL
Template: 3GO5, chain A
Confidence level:very confident
Coverage over the Query: 295-330,341-456,477-504
View the alignment between query and template
View the model in PyMOL
Template: 1HH2, chain P
Confidence level:probable
Coverage over the Query: 253-444
View the alignment between query and template
View the model in PyMOL
Template: 2NN6, chain H
Confidence level:probable
Coverage over the Query: 168-206,241-280
View the alignment between query and template
View the model in PyMOL
Template: 4B9X, chain A
Confidence level:probable
Coverage over the Query: 181-228,246-269,295-397
View the alignment between query and template
View the model in PyMOL