BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010261
         (514 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3A0C|A Chain A, Crystal Structure Of An Anti-Hiv Mannose-Binding Lectin
           From Polygonatum Cyrtonema Hua
 pdb|3A0C|B Chain B, Crystal Structure Of An Anti-Hiv Mannose-Binding Lectin
           From Polygonatum Cyrtonema Hua
 pdb|3A0C|C Chain C, Crystal Structure Of An Anti-Hiv Mannose-Binding Lectin
           From Polygonatum Cyrtonema Hua
 pdb|3A0C|D Chain D, Crystal Structure Of An Anti-Hiv Mannose-Binding Lectin
           From Polygonatum Cyrtonema Hua
 pdb|3A0D|A Chain A, Crystal Structure Of Polygonatum Cyrtonema Lectin (Pcl)
           Complexed With Monomannoside
 pdb|3A0E|A Chain A, Crystal Structure Of Polygonatum Cyrtonema Lectin (Pcl)
           Complexed With Dimannoside
          Length = 110

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 106 SSKPLWLANSTQLAPWSDRIELSFNGSLVISGPHSRVFWSTTR--AEGQRVVIL 157
           S KP+W +N+  L     R+ L  NG+LVI    +RV W T     E   V++L
Sbjct: 37  SGKPVWASNTGGLGS-GCRLTLHNNGNLVIYDQSNRVIWQTKTNGKEDHYVLVL 89


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.133    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,533,154
Number of Sequences: 62578
Number of extensions: 587573
Number of successful extensions: 1300
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1300
Number of HSP's gapped (non-prelim): 2
length of query: 514
length of database: 14,973,337
effective HSP length: 103
effective length of query: 411
effective length of database: 8,527,803
effective search space: 3504927033
effective search space used: 3504927033
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)