Citrus Sinensis ID: 010267


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MFNLKTISLLPIHGTSPLSVFFSTHSSSREHAGHKLNSSCHSGMRRCVKEGYAYSLGNKNLSIKSPDGSNSGEEFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQRR
cccHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHcHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccc
ccHHHHHHHHHHcccccccEHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccc
mfnlktisllpihgtsplsvffsthsssrehaghklnsschsgmrrcVKEGYAyslgnknlsikspdgsnsgeefsgnsynkSIQYCCKLGDIDEAMALLAQMQAlgfhpssiSYASLIEALASVGRTLEADAIFQEMVcfgfnpklRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHvnagrlddTWLIINEMRSkgfqlnsfVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQqesirpdivtWNSLIRWHCKAGDVAKALELFTQMqeqgfypdpkIFITIISCLGELGKWDVIKKNFENmkdrghgkIGAIYAILVDIYgqygrfrdpEECIAALKleglqpsgsMFCILANAYAQQGLCEQTVKVLQLmepegiepnLVMLNVLINAFGVAGKYKEALSVYHLMKdigispdlvTYSTLMKAFIRAKKFHKVPEIYKQmessgctpdrKARQILQSALVVLEQRR
mfnlktisllpihgtsPLSVFFSTHSSSREHAGHklnsschsgmRRCVKEGYAYSLGNKNLSIKSPDGSNSGEEFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRskgfqlnsfVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMessgctpdrkARQILQSALVVLEQRR
MFNLKTISLLPIHGTSPLSVFFSTHSSSREHAGHKLNSSCHSGMRRCVKEGYAYSLGNKNLSIKSPDgsnsgeefsgnsYNKSIQYCCKLGDIDEamallaqmqalGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNIllrgflkkgllglgsrllMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQRR
******ISLLPIHGTSPLSVFF***********************RCVKEGYAYSL***********************YNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYK****************************
MFNLKTISLLPIHGTSPLSVFFSTHSSSREHAGHKLNSSCHSGMRRCVKEGYAYSLGNKNLSIKSPDGSNSGEEFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQR*
MFNLKTISLLPIHGTSPLSVFFS**************SSCHSGMRRCVKEGYAYSLGNKNLSIKS***********GNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQ********DRKARQILQSALVVLEQRR
MFNLKTISLLPIHGTSPLSVFFSTHSSSREHAGHKLNSSCHSGMRRCVKEGYAYSLGNKNLSIKSPDGSNSGEEFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLE***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNLKTISLLPIHGTSPLSVFFSTHSSSREHAGHKLNSSCHSGMRRCVKEGYAYSLGNKNLSIKSPDGSNSGEEFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query514 2.2.26 [Sep-21-2011]
Q8L844709 Pentatricopeptide repeat- yes no 0.824 0.598 0.425 1e-102
Q9FFZ2330 Putative pentatricopeptid no no 0.616 0.960 0.402 5e-75
Q9FIX3 747 Pentatricopeptide repeat- no no 0.813 0.559 0.277 3e-48
Q9LYZ9 819 Pentatricopeptide repeat- no no 0.727 0.456 0.279 3e-45
Q6NQ83619 Pentatricopeptide repeat- no no 0.747 0.620 0.267 9e-44
Q76C99 791 Protein Rf1, mitochondria N/A no 0.657 0.427 0.265 3e-43
Q9CAN5614 Pentatricopeptide repeat- no no 0.803 0.672 0.260 3e-43
Q9CAN0 630 Pentatricopeptide repeat- no no 0.852 0.695 0.261 7e-43
Q9LQ14629 Pentatricopeptide repeat- no no 0.795 0.650 0.265 2e-41
Q0WVK7741 Pentatricopeptide repeat- no no 0.749 0.519 0.252 4e-41
>sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 Back     alignment and function desciption
 Score =  372 bits (954), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/432 (42%), Positives = 269/432 (62%)

Query: 81  NKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVC 140
           N  I    K GD  +A+ LL   QA G    + +  S+I ALA  GRTLEA+A+F+E+  
Sbjct: 273 NDIIMGFAKSGDPSKALQLLGMAQATGLSAKTATLVSIISALADSGRTLEAEALFEELRQ 332

Query: 141 FGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDD 200
            G  P+ R YN LL+G++K G L     ++  ME  G+  ++ TY +L+D +VNAGR + 
Sbjct: 333 SGIKPRTRAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWES 392

Query: 201 TWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIID 260
             +++ EM +   Q NSFV+ +++  +RD G W+K   +++E++ +G+  DRQ YN +ID
Sbjct: 393 ARIVLKEMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID 452

Query: 261 TFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYP 320
           TFGK+  L  A+  F++M  E I PD VTWN+LI  HCK G    A E+F  M+ +G  P
Sbjct: 453 TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLP 512

Query: 321 DPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECI 380
               +  +I+  G+  +WD +K+    MK +G       +  LVD+YG+ GRF D  EC+
Sbjct: 513 CATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL 572

Query: 381 AALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVA 440
             +K  GL+PS +M+  L NAYAQ+GL EQ V   ++M  +G++P+L+ LN LINAFG  
Sbjct: 573 EEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGED 632

Query: 441 GKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKAR 500
            +  EA +V   MK+ G+ PD+VTY+TLMKA IR  KF KVP +Y++M  SGC PDRKAR
Sbjct: 633 RRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVPVVYEEMIMSGCKPDRKAR 692

Query: 501 QILQSALVVLEQ 512
            +L+SAL  ++Q
Sbjct: 693 SMLRSALRYMKQ 704





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FFZ2|PP402_ARATH Putative pentatricopeptide repeat-containing protein At5g36300 OS=Arabidopsis thaliana GN=At5g36300 PE=3 SV=3 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
255557939498 pentatricopeptide repeat-containing prot 0.879 0.907 0.730 0.0
359490014494 PREDICTED: pentatricopeptide repeat-cont 0.883 0.919 0.709 0.0
356540373 881 PREDICTED: pentatricopeptide repeat-cont 0.883 0.515 0.673 0.0
356495758554 PREDICTED: pentatricopeptide repeat-cont 0.902 0.837 0.653 1e-179
147778635466 hypothetical protein VITISV_005528 [Viti 0.836 0.922 0.665 1e-175
410129734517 bvCRP-1 [Beta vulgaris] 0.976 0.970 0.583 1e-169
297801170448 hypothetical protein ARALYDRAFT_330235 [ 0.834 0.957 0.620 1e-160
297725255492 Os06g0710800 [Oryza sativa Japonica Grou 0.879 0.918 0.573 1e-155
357123699492 PREDICTED: pentatricopeptide repeat-cont 0.871 0.910 0.567 1e-153
326527817491 predicted protein [Hordeum vulgare subsp 0.852 0.892 0.564 1e-144
>gi|255557939|ref|XP_002519998.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540762|gb|EEF42322.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/452 (73%), Positives = 395/452 (87%)

Query: 62  SIKSPDGSNSGEEFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEA 121
           S+  P   ++G+E SG SYN  I  CCK+GD+D+AM LLA MQ+LGFHPSS+SY  LIE 
Sbjct: 6   SVTMPTNESTGQELSGESYNSCICDCCKVGDVDKAMTLLADMQSLGFHPSSLSYTCLIET 65

Query: 122 LASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRN 181
           L SVGRTLEA+A++QEM+CFG  P+L+ YNI+LRGFLKKGLL +  R+L +++D+G+ RN
Sbjct: 66  LLSVGRTLEAEALYQEMMCFGLKPRLKLYNIMLRGFLKKGLLRVAERVLRILDDLGLHRN 125

Query: 182 QETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVE 241
           QETYEILLDY+VNAGRL+DTW +INEM+ KGFQLNSFVY KVIGLYRDNGMWKKA+GI+E
Sbjct: 126 QETYEILLDYNVNAGRLEDTWSVINEMKQKGFQLNSFVYSKVIGLYRDNGMWKKAIGIIE 185

Query: 242 EIREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAG 301
           EIREMG+ LD+ IYNSIIDTFGKYGEL EALEV   MQQ+ I PDIVTWNSLIRWHCKAG
Sbjct: 186 EIREMGMPLDKHIYNSIIDTFGKYGELDEALEVLSNMQQQGITPDIVTWNSLIRWHCKAG 245

Query: 302 DVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYA 361
           +++KALELF++MQ QG YPDPKI +TIIS L E GKW++I++NF+ MK  G+ K GAIYA
Sbjct: 246 NLSKALELFSKMQAQGLYPDPKILVTIISRLAEQGKWNIIRENFDIMKSWGYKKSGAIYA 305

Query: 362 ILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPE 421
           ILVDIYGQYGRF+D EECI+ALK EG+ PS SMFC+LANAYAQQGLCEQTVKVLQLME E
Sbjct: 306 ILVDIYGQYGRFQDAEECISALKSEGILPSASMFCVLANAYAQQGLCEQTVKVLQLMEAE 365

Query: 422 GIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKV 481
           GIEPNL+MLNVLINAFG+AG+++EALS+YH MK+ GISPD+VTYSTLMKA+IRA+KF +V
Sbjct: 366 GIEPNLIMLNVLINAFGIAGRHREALSIYHHMKESGISPDVVTYSTLMKAYIRARKFDEV 425

Query: 482 PEIYKQMESSGCTPDRKARQILQSALVVLEQR 513
           PEIY +MESSGCTPD+KAR+ILQ+AL+VL +R
Sbjct: 426 PEIYSEMESSGCTPDKKAREILQAALMVLGRR 457




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490014|ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356540373|ref|XP_003538664.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] Back     alignment and taxonomy information
>gi|356495758|ref|XP_003516740.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|147778635|emb|CAN76113.1| hypothetical protein VITISV_005528 [Vitis vinifera] Back     alignment and taxonomy information
>gi|410129734|dbj|BAM64814.1| bvCRP-1 [Beta vulgaris] Back     alignment and taxonomy information
>gi|297801170|ref|XP_002868469.1| hypothetical protein ARALYDRAFT_330235 [Arabidopsis lyrata subsp. lyrata] gi|297314305|gb|EFH44728.1| hypothetical protein ARALYDRAFT_330235 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297725255|ref|NP_001174991.1| Os06g0710800 [Oryza sativa Japonica Group] gi|53792631|dbj|BAD53645.1| putative crp1 protein [Oryza sativa Japonica Group] gi|215693375|dbj|BAG88757.1| unnamed protein product [Oryza sativa Japonica Group] gi|255677390|dbj|BAH93719.1| Os06g0710800 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357123699|ref|XP_003563545.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326527817|dbj|BAJ88981.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
TAIR|locus:2157607709 AT5G42310 [Arabidopsis thalian 0.840 0.609 0.400 1e-84
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.813 0.559 0.256 4.6e-40
TAIR|locus:2151281 819 AT5G02860 [Arabidopsis thalian 0.735 0.461 0.262 1.6e-37
TAIR|locus:2060226624 AT2G32630 "AT2G32630" [Arabido 0.747 0.615 0.259 1.6e-36
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.809 0.672 0.245 7.2e-36
TAIR|locus:2015208 630 AT1G63130 [Arabidopsis thalian 0.772 0.630 0.248 6.3e-35
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.795 0.649 0.237 3.8e-33
TAIR|locus:2150024729 AT5G01110 [Arabidopsis thalian 0.809 0.570 0.244 1.1e-32
TAIR|locus:2155730 915 AT5G65560 "AT5G65560" [Arabido 0.803 0.451 0.240 1.5e-32
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.809 0.677 0.233 1.5e-32
TAIR|locus:2157607 AT5G42310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 848 (303.6 bits), Expect = 1.0e-84, P = 1.0e-84
 Identities = 173/432 (40%), Positives = 252/432 (58%)

Query:    81 NKSIQYCCKLGDIDEXXXXXXXXXXXGFHPSSISYASLIEALASVGRTLEADAIFQEMVC 140
             N  I    K GD  +           G    + +  S+I ALA  GRTLEA+A+F+E+  
Sbjct:   273 NDIIMGFAKSGDPSKALQLLGMAQATGLSAKTATLVSIISALADSGRTLEAEALFEELRQ 332

Query:   141 FGFNPKLRFYNIXXXXXXXXXXXXXXXXXXMVMEDMGICRNQETYEILLDYHVNAGRLDD 200
              G  P+ R YN                     ME  G+  ++ TY +L+D +VNAGR + 
Sbjct:   333 SGIKPRTRAYNALLKGYVKTGPLKDAESMVSEMEKRGVSPDEHTYSLLIDAYVNAGRWES 392

Query:   201 TWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIID 260
               +++ EM +   Q NSFV+ +++  +RD G W+K   +++E++ +G+  DRQ YN +ID
Sbjct:   393 ARIVLKEMEAGDVQPNSFVFSRLLAGFRDRGEWQKTFQVLKEMKSIGVKPDRQFYNVVID 452

Query:   261 TFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYP 320
             TFGK+  L  A+  F++M  E I PD VTWN+LI  HCK G    A E+F  M+ +G  P
Sbjct:   453 TFGKFNCLDHAMTTFDRMLSEGIEPDRVTWNTLIDCHCKHGRHIVAEEMFEAMERRGCLP 512

Query:   321 DPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECI 380
                 +  +I+  G+  +WD +K+    MK +G       +  LVD+YG+ GRF D  EC+
Sbjct:   513 CATTYNIMINSYGDQERWDDMKRLLGKMKSQGILPNVVTHTTLVDVYGKSGRFNDAIECL 572

Query:   381 AALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVA 440
               +K  GL+PS +M+  L NAYAQ+GL EQ V   ++M  +G++P+L+ LN LINAFG  
Sbjct:   573 EEMKSVGLKPSSTMYNALINAYAQRGLSEQAVNAFRVMTSDGLKPSLLALNSLINAFGED 632

Query:   441 GKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKAR 500
              +  EA +V   MK+ G+ PD+VTY+TLMKA IR  KF KVP +Y++M  SGC PDRKAR
Sbjct:   633 RRDAEAFAVLQYMKENGVKPDVVTYTTLMKALIRVDKFQKVPVVYEEMIMSGCKPDRKAR 692

Query:   501 QILQSALVVLEQ 512
              +L+SAL  ++Q
Sbjct:   693 SMLRSALRYMKQ 704


GO:0005739 "mitochondrion" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151281 AT5G02860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060226 AT2G32630 "AT2G32630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00014080001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (490 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-30
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-23
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-22
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-22
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-20
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-18
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-11
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-10
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
pfam0153531 pfam01535, PPR, PPR repeat 2e-06
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 9e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 6e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-04
pfam0153531 pfam01535, PPR, PPR repeat 8e-04
pfam0153531 pfam01535, PPR, PPR repeat 8e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.003
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  126 bits (318), Expect = 1e-30
 Identities = 93/409 (22%), Positives = 186/409 (45%), Gaps = 7/409 (1%)

Query: 91  GDIDEAMALLAQMQALG-FHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRF 149
           G I + + LL  M+  G      I +A   +A        EA   F +++    NP L  
Sbjct: 384 GRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFR-FAKLI---RNPTLST 439

Query: 150 YNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMR 209
           +N+L+        +    R+L ++++ G+  + + Y  L+     +G++D  + + +EM 
Sbjct: 440 FNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMV 499

Query: 210 SKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSIIDTFGKYGELV 269
           + G + N   +G +I      G   KA G    +R   +  DR ++N++I   G+ G + 
Sbjct: 500 NAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVD 559

Query: 270 EALEVFEKMQQES--IRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFIT 327
            A +V  +M+ E+  I PD +T  +L++    AG V +A E++  + E      P+++  
Sbjct: 560 RAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTI 619

Query: 328 IISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEG 387
            ++   + G WD     +++MK +G       ++ LVD+ G  G      E +   + +G
Sbjct: 620 AVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQG 679

Query: 388 LQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEAL 447
           ++     +  L  A +     ++ +++ + ++   + P +  +N LI A     +  +AL
Sbjct: 680 IKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKAL 739

Query: 448 SVYHLMKDIGISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPD 496
            V   MK +G+ P+ +TYS L+ A  R        ++  Q +  G  P+
Sbjct: 740 EVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPN 788


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 514
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.98
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
PRK14574 822 hmsH outer membrane protein; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.84
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.82
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
PRK14574 822 hmsH outer membrane protein; Provisional 99.77
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.76
KOG2003 840 consensus TPR repeat-containing protein [General f 99.74
KOG2076 895 consensus RNA polymerase III transcription factor 99.69
KOG2003840 consensus TPR repeat-containing protein [General f 99.68
KOG2076 895 consensus RNA polymerase III transcription factor 99.65
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.65
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.65
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.63
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.62
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.61
KOG0547606 consensus Translocase of outer mitochondrial membr 99.61
KOG1915677 consensus Cell cycle control protein (crooked neck 99.61
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.58
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.56
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.55
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
KOG1126638 consensus DNA-binding cell division cycle control 99.53
KOG1126638 consensus DNA-binding cell division cycle control 99.52
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.5
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.46
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.45
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.44
PRK12370553 invasion protein regulator; Provisional 99.41
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.41
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.41
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.4
KOG0547606 consensus Translocase of outer mitochondrial membr 99.4
PF1304150 PPR_2: PPR repeat family 99.4
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.39
PRK12370553 invasion protein regulator; Provisional 99.37
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.37
KOG1129478 consensus TPR repeat-containing protein [General f 99.36
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.33
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.33
PF1304150 PPR_2: PPR repeat family 99.33
KOG1129478 consensus TPR repeat-containing protein [General f 99.32
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.29
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.25
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.25
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.23
PRK11189296 lipoprotein NlpI; Provisional 99.18
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.17
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.17
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.15
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.14
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.12
PRK11189296 lipoprotein NlpI; Provisional 99.1
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.09
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.07
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.05
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.05
PRK04841 903 transcriptional regulator MalT; Provisional 99.02
PRK04841903 transcriptional regulator MalT; Provisional 99.0
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.97
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.96
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.93
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.93
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.91
KOG1125579 consensus TPR repeat-containing protein [General f 98.89
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.86
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.86
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.84
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.84
PLN02789320 farnesyltranstransferase 98.82
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.81
PF1285434 PPR_1: PPR repeat 98.77
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.77
PF1285434 PPR_1: PPR repeat 98.76
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.76
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.76
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.7
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.7
KOG1125579 consensus TPR repeat-containing protein [General f 98.7
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.69
PLN02789320 farnesyltranstransferase 98.69
PRK10370198 formate-dependent nitrite reductase complex subuni 98.69
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.68
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.63
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.63
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.61
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.56
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.55
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.54
KOG1128777 consensus Uncharacterized conserved protein, conta 98.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.51
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.51
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.49
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.49
PRK10370198 formate-dependent nitrite reductase complex subuni 98.48
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.47
PRK15359144 type III secretion system chaperone protein SscB; 98.46
PRK15359144 type III secretion system chaperone protein SscB; 98.43
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.35
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.34
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.29
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.25
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.25
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.24
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.23
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.2
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.15
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.13
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.07
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.07
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.06
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.06
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.02
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.01
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.91
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.9
KOG20411189 consensus WD40 repeat protein [General function pr 97.9
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.89
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.86
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.82
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.8
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.74
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.74
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.74
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.73
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.7
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.69
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.68
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.67
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.67
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.67
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.66
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.65
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.65
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.65
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.64
KOG20411189 consensus WD40 repeat protein [General function pr 97.64
KOG0553304 consensus TPR repeat-containing protein [General f 97.62
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.6
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.59
KOG0553304 consensus TPR repeat-containing protein [General f 97.57
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.57
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.56
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.54
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.52
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.46
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.44
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.42
PF12688120 TPR_5: Tetratrico peptide repeat 97.41
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.39
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.38
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.38
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.35
COG4700251 Uncharacterized protein conserved in bacteria cont 97.31
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.28
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.26
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.25
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.23
COG4700251 Uncharacterized protein conserved in bacteria cont 97.22
PF12688120 TPR_5: Tetratrico peptide repeat 97.18
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.17
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.14
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.08
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.05
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.03
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.02
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.02
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.01
PF1337173 TPR_9: Tetratricopeptide repeat 96.99
PRK10803263 tol-pal system protein YbgF; Provisional 96.94
PRK10803263 tol-pal system protein YbgF; Provisional 96.86
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.85
KOG1585308 consensus Protein required for fusion of vesicles 96.82
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.77
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.72
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.67
PF1337173 TPR_9: Tetratricopeptide repeat 96.66
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.65
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.64
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.61
PRK15331165 chaperone protein SicA; Provisional 96.58
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.5
PRK15331165 chaperone protein SicA; Provisional 96.37
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.34
COG3898531 Uncharacterized membrane-bound protein [Function u 96.34
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.34
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.23
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.19
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.15
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.04
KOG3941406 consensus Intermediate in Toll signal transduction 96.03
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.0
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.94
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.93
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.9
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.89
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.88
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.86
smart00299140 CLH Clathrin heavy chain repeat homology. 95.82
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.78
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.78
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.75
smart00299140 CLH Clathrin heavy chain repeat homology. 95.67
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.64
COG3898 531 Uncharacterized membrane-bound protein [Function u 95.64
KOG3941 406 consensus Intermediate in Toll signal transduction 95.54
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.49
COG3629280 DnrI DNA-binding transcriptional activator of the 95.38
KOG4555175 consensus TPR repeat-containing protein [Function 95.31
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.26
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.24
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.1
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.98
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.93
PRK11906458 transcriptional regulator; Provisional 94.6
PF1342844 TPR_14: Tetratricopeptide repeat 94.57
KOG1585308 consensus Protein required for fusion of vesicles 94.56
KOG4555175 consensus TPR repeat-containing protein [Function 94.49
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.47
PRK11906458 transcriptional regulator; Provisional 94.42
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.34
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.34
PF1342844 TPR_14: Tetratricopeptide repeat 94.3
KOG1258577 consensus mRNA processing protein [RNA processing 94.24
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.2
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.19
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.18
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.13
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 94.08
PF13512142 TPR_18: Tetratricopeptide repeat 93.98
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.93
KOG1258577 consensus mRNA processing protein [RNA processing 93.88
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.8
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.64
PF13512142 TPR_18: Tetratricopeptide repeat 93.63
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.62
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.58
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.51
COG3629280 DnrI DNA-binding transcriptional activator of the 93.47
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.33
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.2
KOG1550552 consensus Extracellular protein SEL-1 and related 93.2
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.18
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.95
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.79
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.47
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.41
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.35
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.14
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.91
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.19
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.96
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.43
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.23
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.03
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.99
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 89.95
KOG4570418 consensus Uncharacterized conserved protein [Funct 89.89
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.54
PF1343134 TPR_17: Tetratricopeptide repeat 89.53
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 89.47
PF1343134 TPR_17: Tetratricopeptide repeat 89.23
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 89.14
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.1
PF13929292 mRNA_stabil: mRNA stabilisation 89.03
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.9
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.31
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.81
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.63
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 87.54
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.52
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 87.38
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.36
COG2976207 Uncharacterized protein conserved in bacteria [Fun 87.2
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.98
COG3947361 Response regulator containing CheY-like receiver a 86.98
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 86.43
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.27
KOG4234271 consensus TPR repeat-containing protein [General f 86.08
KOG4648536 consensus Uncharacterized conserved protein, conta 85.24
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.24
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.84
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 84.68
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.67
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 84.07
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.6
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.55
KOG1550552 consensus Extracellular protein SEL-1 and related 83.19
KOG2471 696 consensus TPR repeat-containing protein [General f 82.75
COG4455 273 ImpE Protein of avirulence locus involved in tempe 82.39
COG2976207 Uncharacterized protein conserved in bacteria [Fun 82.1
KOG4234271 consensus TPR repeat-containing protein [General f 81.74
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 81.73
PRK09687280 putative lyase; Provisional 81.73
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 80.24
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 80.09
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.08
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.7e-68  Score=544.97  Aligned_cols=436  Identities=19%  Similarity=0.293  Sum_probs=400.0

Q ss_pred             ccCcchHHHHHHHHHhcCCHHHHHHHHHHHHHCCCC--------------------------------CCHhhHHHHHHH
Q 010267           74 EFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFH--------------------------------PSSISYASLIEA  121 (514)
Q Consensus        74 ~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~--------------------------------~~~~~~~~li~~  121 (514)
                      .++...|..++..|++.|++++|+++|++|.+.|+.                                ||..+|+.++.+
T Consensus       367 ~~~~~~~~~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~pd~~Tyn~LL~a  446 (1060)
T PLN03218        367 KRKSPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRNPTLSTFNMLMSV  446 (1060)
T ss_pred             CCCchHHHHHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCCCCHHHHHHHHHH
Confidence            345556667777777777777777777777766642                                788899999999


Q ss_pred             HHhcCChHHHHHHHHHHHHcCCCCChHhHHHHHHHHHhcCChhhHHHHHHHHHHcCCCcChHhHHHHHHHHHhcCCHHHH
Q 010267          122 LASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGLLGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDT  201 (514)
Q Consensus       122 ~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A  201 (514)
                      |++.|+++.|.++|+.|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|
T Consensus       447 ~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeA  526 (1060)
T PLN03218        447 CASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKA  526 (1060)
T ss_pred             HHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCChhhHHHHHHHHHccCChHHHHHHHHHHHH--cCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHHH
Q 010267          202 WLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIRE--MGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQ  279 (514)
Q Consensus       202 ~~~~~~m~~~g~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~--~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~  279 (514)
                      .++|++|.+.|+.||..+|+.++.+|++.|++++|.++|++|..  .++.||..+|+.+|.+|++.|++++|.++|++|.
T Consensus       527 l~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~  606 (1060)
T PLN03218        527 FGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIH  606 (1060)
T ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999976  6789999999999999999999999999999999


Q ss_pred             HCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHhcCCCCcHHH
Q 010267          280 QESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAI  359 (514)
Q Consensus       280 ~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~  359 (514)
                      +.|+.|+..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.++.+|++.|++++|.++++.|.+.|+.|+..+
T Consensus       607 e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~t  686 (1060)
T PLN03218        607 EYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVS  686 (1060)
T ss_pred             HcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCcchHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhhCCCCCCHHHHHHHHHHHHH
Q 010267          360 YAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGV  439 (514)
Q Consensus       360 ~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~li~~~~~  439 (514)
                      |+.+|.+|++.|++++|.++|++|.+.++.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..||+.++.+|++
T Consensus       687 ynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k  766 (1060)
T PLN03218        687 YSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASER  766 (1060)
T ss_pred             HHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHHHCCCCcCHHHHHHHHHHHHc----C-------------------CCcchHHHHHHHHHhCCCCCC
Q 010267          440 AGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIR----A-------------------KKFHKVPEIYKQMESSGCTPD  496 (514)
Q Consensus       440 ~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~----~-------------------g~~~~a~~~~~~m~~~g~~p~  496 (514)
                      .|++++|.++|++|.+.|+.||..+|++++..|.+    .                   +..++|..+|++|.+.|+.||
T Consensus       767 ~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~~Al~lf~eM~~~Gi~Pd  846 (1060)
T PLN03218        767 KDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMVYRETISAGTLPT  846 (1060)
T ss_pred             CCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHHHHHHHHHHHHHCCCCCC
Confidence            99999999999999999999999999999876542    1                   123679999999999999999


Q ss_pred             HHHHHHHHHHHHH
Q 010267          497 RKARQILQSALVV  509 (514)
Q Consensus       497 ~~~~~~l~~a~~~  509 (514)
                      ..|+..++.+++.
T Consensus       847 ~~T~~~vL~cl~~  859 (1060)
T PLN03218        847 MEVLSQVLGCLQL  859 (1060)
T ss_pred             HHHHHHHHHHhcc
Confidence            9999999966543



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 76.0 bits (185), Expect = 1e-14
 Identities = 24/197 (12%), Positives = 59/197 (29%), Gaps = 4/197 (2%)

Query: 199 DDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSI 258
                + +  R            +++                 +  +  LS  +Q   + 
Sbjct: 74  QMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAF 133

Query: 259 IDTFGKYGELVEA---LEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQE 315
                   +L  A   L V    +Q+     +  +N+++    + G   + + +   +++
Sbjct: 134 FKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKD 193

Query: 316 QGFYPDPKIFITIISCLGELGK-WDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFR 374
            G  PD   +   + C+G   +    I++  E M   G        A+L+    +    +
Sbjct: 194 AGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLK 253

Query: 375 DPEECIAALKLEGLQPS 391
              +      L    P 
Sbjct: 254 AVHKVKPTFSLPPQLPP 270


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.82
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.82
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.8
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.77
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.77
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.76
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.74
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.73
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.64
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.63
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.62
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.61
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.61
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.61
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.61
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.6
3u4t_A272 TPR repeat-containing protein; structural genomics 99.6
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.52
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.51
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.5
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.49
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.48
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.48
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.45
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.45
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.45
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.38
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.35
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.35
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.26
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.2
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.18
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.15
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.11
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.1
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.04
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.02
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.02
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.02
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.01
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.99
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.96
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.95
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.94
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.92
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.92
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.9
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.89
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.88
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.88
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.87
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.81
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.77
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.73
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.72
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.7
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.69
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.69
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.68
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.66
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.64
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.62
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.62
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.62
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.62
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.61
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.59
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.58
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.58
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.53
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.52
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.52
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.52
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.51
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.51
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.48
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.47
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.47
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.47
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.45
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.43
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.4
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.4
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.38
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.38
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.37
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.35
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.34
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.34
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.33
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.32
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.31
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.3
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.3
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.28
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.28
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.24
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.24
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.19
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.17
3k9i_A117 BH0479 protein; putative protein binding protein, 98.13
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.12
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.06
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.05
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.03
3k9i_A117 BH0479 protein; putative protein binding protein, 98.02
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.02
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.02
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.99
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.97
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.96
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.93
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.92
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.89
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.88
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.84
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.8
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.78
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.76
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.68
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.67
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.65
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.64
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.6
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.59
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.57
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.54
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.41
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.15
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.09
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.98
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.88
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.72
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.7
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.67
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.6
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.47
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.42
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.24
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.22
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.21
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.03
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.91
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.88
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.87
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.81
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.74
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.7
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.45
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.31
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.25
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.04
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.99
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.94
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.14
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.62
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.55
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.32
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.91
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.46
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.23
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.09
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.88
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 90.34
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.33
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.89
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 89.29
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.97
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.3
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.78
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 87.69
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.12
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 86.72
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.64
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.07
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 84.05
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.75
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 82.76
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 81.82
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.18
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=6.8e-39  Score=325.72  Aligned_cols=427  Identities=10%  Similarity=0.003  Sum_probs=309.3

Q ss_pred             CccCcchHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCChHhHHH
Q 010267           73 EEFSGNSYNKSIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNI  152 (514)
Q Consensus        73 ~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~  152 (514)
                      +.+++..|+.++..|.+.|++++|+.+|++|...  .|+..++..++.+|.+.|++++|..+|+.+...  +++..+++.
T Consensus        80 ~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~  155 (597)
T 2xpi_A           80 SLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY--NRSSACRYL  155 (597)
T ss_dssp             --CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GTCHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc--ccchhHHHH
Confidence            4467889999999999999999999999999865  578899999999999999999999999988653  688999999


Q ss_pred             HHHHHHhcCChhhHHHHHHHHH-Hc--------------CCCcChHhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCh
Q 010267          153 LLRGFLKKGLLGLGSRLLMVME-DM--------------GICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNS  217 (514)
Q Consensus       153 li~~~~~~g~~~~A~~~~~~~~-~~--------------~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~  217 (514)
                      ++.+|.+.|++++|.++|+++. ..              +..++..+|+.++.+|.+.|++++|.++|++|.+.+.. +.
T Consensus       156 l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~  234 (597)
T 2xpi_A          156 AAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CY  234 (597)
T ss_dssp             HHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CH
T ss_pred             HHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hh
Confidence            9999999999999999999532 21              22346889999999999999999999999999876432 22


Q ss_pred             hhHHHH--------------------------------------HHHHHccCChHHHHHHHHHHHHcCCCCCHHHHHHHH
Q 010267          218 FVYGKV--------------------------------------IGLYRDNGMWKKAVGIVEEIREMGLSLDRQIYNSII  259 (514)
Q Consensus       218 ~~~~~l--------------------------------------l~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li  259 (514)
                      ..+..+                                      +..|.+.|++++|.++|+++.+.  +++..+++.++
T Consensus       235 ~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~  312 (597)
T 2xpi_A          235 EAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKA  312 (597)
T ss_dssp             HHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHH
T ss_pred             HHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHH
Confidence            222222                                      33445567777777777777654  46777777777


Q ss_pred             HHHhccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHH
Q 010267          260 DTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDPKIFITIISCLGELGKWD  339 (514)
Q Consensus       260 ~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~  339 (514)
                      .+|.+.|++++|.++|+++.+.+. .+..+|+.++.++.+.|++++|..+++++.+. .+.+..++..++..|.+.|+++
T Consensus       313 ~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~g~~~  390 (597)
T 2xpi_A          313 DTLFVRSRFIDVLAITTKILEIDP-YNLDVYPLHLASLHESGEKNKLYLISNDLVDR-HPEKAVTWLAVGIYYLCVNKIS  390 (597)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHCT-TCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHH-CTTSHHHHHHHHHHHHHTTCHH
T ss_pred             HHHHHhcCHHHHHHHHHHHHHcCc-ccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhh-CcccHHHHHHHHHHHHHhccHH
Confidence            777777777777777777765432 25556677777777777777777777777653 2335666667777777777777


Q ss_pred             HHHHHHHHHHhcCCCCcHHHHHHHHHHHHhcCCcchHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhh
Q 010267          340 VIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAYAQQGLCEQTVKVLQLME  419 (514)
Q Consensus       340 ~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~~  419 (514)
                      +|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.+. .+..+|..++.+|.+.|++++|.++|+++.
T Consensus       391 ~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~  468 (597)
T 2xpi_A          391 EARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQ-GTHLPYLFLGMQHMQLGNILLANEYLQSSY  468 (597)
T ss_dssp             HHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTT-TCSHHHHHHHHHHHHHTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCc-cchHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence            7777777766643 34566677777777777777777777777665532 355667777777777777777777777776


Q ss_pred             hCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHC----CCCcC--HHHHHHHHHHHHcCCCcchHHHHHHHHHhCCC
Q 010267          420 PEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDI----GISPD--LVTYSTLMKAFIRAKKFHKVPEIYKQMESSGC  493 (514)
Q Consensus       420 ~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~----~~~p~--~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~g~  493 (514)
                      +.. +.+..+|+.++.+|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.++++++.+.+ 
T Consensus       469 ~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-  546 (597)
T 2xpi_A          469 ALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-  546 (597)
T ss_dssp             HHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-
T ss_pred             HhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-
Confidence            543 345666777777777777777777777776554    44555  5667777777777777777777777776642 


Q ss_pred             CCCHHHHHHHHHHHHHhhh
Q 010267          494 TPDRKARQILQSALVVLEQ  512 (514)
Q Consensus       494 ~p~~~~~~~l~~a~~~~~~  512 (514)
                      +.+..++..+..++...|+
T Consensus       547 p~~~~~~~~l~~~~~~~g~  565 (597)
T 2xpi_A          547 TNDANVHTAIALVYLHKKI  565 (597)
T ss_dssp             SCCHHHHHHHHHHHHHTTC
T ss_pred             CCChHHHHHHHHHHHHhCC
Confidence            2356666666666665543



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.63
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.27
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.24
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.22
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.2
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.19
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.16
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.09
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.04
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.0
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.98
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.71
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.62
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.61
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.51
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.41
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.39
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.38
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.35
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.32
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.3
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.19
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.19
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.13
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.04
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.98
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.95
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.94
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.92
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.9
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.83
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.8
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.74
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.72
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.65
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.64
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.63
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.41
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.4
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.16
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.94
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.44
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.39
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.25
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.14
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.92
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.29
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.45
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.06
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.12
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=4.1e-22  Score=187.95  Aligned_cols=384  Identities=14%  Similarity=0.050  Sum_probs=279.2

Q ss_pred             HHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCChHhHHHHHHHHHhcCC
Q 010267           83 SIQYCCKLGDIDEAMALLAQMQALGFHPSSISYASLIEALASVGRTLEADAIFQEMVCFGFNPKLRFYNILLRGFLKKGL  162 (514)
Q Consensus        83 li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~  162 (514)
                      +...+.+.|++++|++.|+++.+.. +-+...+..+...+.+.|++++|...|+++.+.. +.+..+|..+..+|.+.|+
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~   82 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhcc
Confidence            4566778899999999999988764 4467888889999999999999999999998865 4567788899999999999


Q ss_pred             hhhHHHHHHHHHHcCCCcChHhHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCChhhHHHHHHHHHccCChHHHHHHHHH
Q 010267          163 LGLGSRLLMVMEDMGICRNQETYEILLDYHVNAGRLDDTWLIINEMRSKGFQLNSFVYGKVIGLYRDNGMWKKAVGIVEE  242 (514)
Q Consensus       163 ~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~  242 (514)
                      +++|.+.+....+... .+...+..........+....+............. ...............+....+...+..
T Consensus        83 ~~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (388)
T d1w3ba_          83 LQEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD-LYCVRSDLGNLLKALGRLEEAKACYLK  160 (388)
T ss_dssp             HHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTT-CTHHHHHHHHHHHTTSCHHHHHHHHHH
T ss_pred             cccccccccccccccc-ccccccccccccccccccccccccccccccccccc-cccccccccccccccchhhhhHHHHHH
Confidence            9999999999887654 34445555555555666666666655555544322 444455556667777788888888877


Q ss_pred             HHHcCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCH
Q 010267          243 IREMGLSLDRQIYNSIIDTFGKYGELVEALEVFEKMQQESIRPDIVTWNSLIRWHCKAGDVAKALELFTQMQEQGFYPDP  322 (514)
Q Consensus       243 ~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~  322 (514)
                      ..... +.+...+..+...+...|++++|...+++..+.. +-+...|..+...+...|++++|+..+++..... ..+.
T Consensus       161 ~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~  237 (388)
T d1w3ba_         161 AIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHA  237 (388)
T ss_dssp             HHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCH
T ss_pred             hhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHH
Confidence            77654 4466777778888888888888888888877643 2256677788888888888888888888877653 3356


Q ss_pred             HHHHHHHHHHHccCCHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhcCCcchHHHHHHHHHHcCCCCCHHHHHHHHHHH
Q 010267          323 KIFITIISCLGELGKWDVIKKNFENMKDRGHGKIGAIYAILVDIYGQYGRFRDPEECIAALKLEGLQPSGSMFCILANAY  402 (514)
Q Consensus       323 ~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~  402 (514)
                      ..+..+...+.+.|++++|...++++.+.. +.+..++..+...+...|++++|.+.++...... +.+...+..+...+
T Consensus       238 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~  315 (388)
T d1w3ba_         238 VVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIK  315 (388)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHH
Confidence            667777777888888888888888877764 3456677777777777777777777777776653 34566667777777


Q ss_pred             HhcCCHHHHHHHHHHhhhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCcCHHHHHHHHHHHHcCCC
Q 010267          403 AQQGLCEQTVKVLQLMEPEGIEPNLVMLNVLINAFGVAGKYKEALSVYHLMKDIGISPDLVTYSTLMKAFIRAKK  477 (514)
Q Consensus       403 ~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~  477 (514)
                      ...|++++|.+.+++..+.. +-+..++..+..+|.+.|++++|.+.|+++.+..+. +...|..+..+|.+.||
T Consensus       316 ~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~-~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         316 REQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPT-FADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTT-CHHHHHHHHHHHHHTCC
T ss_pred             HHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCC
Confidence            77777777777777776642 334566777777777777777777777777664322 45567777777766654



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure