Citrus Sinensis ID: 010309

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---

MNKDWKAPCPPDWIINEEKSKCFGYIGNFRSWDESETYCKEIGGHLAALTSYEEEHSAQKLCGKNVNGCWVGGRSINTTVGLSWKWSDNMSKWNESIHAVGSFNSSCTSLPCHVHATVDLCTLVSNGSRSLVTERCNTSHPFICMVEHENKCYYLHCHREYLITLGVVSGLILLTTFAIVIWLLAYRRSKRRRKSRKLSNPAASALVPPSWKVFTTEELRSITKNFSEGNRLLGDSKTGGTYSGILPDGSRVAVKRLKRSSFQRKKEFYSEIGRFARLHHPNLVAVKGCCYDHGDRYIVYEFVVNGPLDRWLHHIPRGGRSLDWAMRMKVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMQERTVMAGGTYGYLAPEFVYRNELTTKSDVYSFGVLLLEIVSGRRPAQAVDSVCWQSIFEWATPLVQSHRYLELLDPLISSLSSDIPEAGVVQKVVDLVYACTQHVPSMRPRMSHVVHQLQQLAQPPVTK

cccccccccccccccccccccCEEEEccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccccCEEccCECcccccccCECccccccccccccccccccccccccccccccccccCECccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccEEEEEECcccEEEEEEEcccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEcEEccccccccHHHHccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccc

******A*CPPDWIINEEKSKCFGYIGNFRSWDESETYCKEIGGHLAALTSYEEEHSAQKLCGKNVNGCWVGGRSINTTVGLSWKWSDNMSKWNESIHAVGSFNSSCTSLPCHVHATVDLCTLVSNGSRSLVTERCNTSHPFICMVEHENKC****CHREYLITLGVVSGLILLTTFAIVIWLLAYR**********************SWKVFTTEELRSITKNFSEGNRLLGDSKTGGTYSGILPDGSRVAVKR*K***FQRKKEFYSEIGRFARLHHPNLVAVKGCCYDHGDRYIVYEFVVNGPLDRWLHHIPRGGRSLDWAMRMKVATTLAQGIAFLHDKVKPHVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWEVMQERTVMAGGTYGYLAPEFVYRNELTTKSDVYSFGVLLLEIVSGRRPAQAVDSVCWQSIFEWATPLVQSHRYLELLDPLISSLSSDIPEAGVVQKVVDLVYACTQHVPSMRPRMSHVVHQLQQLA******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
C-type lectin receptor-like tyrosine-protein kinase At1g52310		probable	Q9C823

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 319-453,467-508
View the alignment between query and template
View the model in PyMOL

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 210-507
View the alignment between query and template
View the model in PyMOL

Template: 2B6B, chain D
Confidence level:very confident
Coverage over the Query: 8-103,115-150
View the alignment between query and template
View the model in PyMOL

Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 159-191
View the alignment between query and template
View the model in PyMOL