BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010352
(512 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1MBM|A Chain A, Nsp4 Proteinase From Equine Arteritis Virus
pdb|1MBM|B Chain B, Nsp4 Proteinase From Equine Arteritis Virus
pdb|1MBM|C Chain C, Nsp4 Proteinase From Equine Arteritis Virus
pdb|1MBM|D Chain D, Nsp4 Proteinase From Equine Arteritis Virus
Length = 198
Score = 32.0 bits (71), Expect = 0.92, Method: Compositional matrix adjust.
Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
Query: 93 HLASPKWGPFASWCCAWLETIGLIAGM-----GTQAYAGSQTLQ--SIILLCTGTNKDG 144
H A P GP ASWC A + GL++G T +GS +Q +++ + TG+N G
Sbjct: 78 HFAQPTTGP-ASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSG 135
>pdb|1G8P|A Chain A, Crystal Structure Of Bchi Subunit Of Magnesium Chelatase
pdb|2X31|G Chain G, Modelling Of The Complex Between Subunits Bchi And Bchd Of
Magnesium Chelatase Based On Single-Particle Cryo-Em
Reconstruction At 7.5 Ang
pdb|2X31|H Chain H, Modelling Of The Complex Between Subunits Bchi And Bchd Of
Magnesium Chelatase Based On Single-Particle Cryo-Em
Reconstruction At 7.5 Ang
pdb|2X31|I Chain I, Modelling Of The Complex Between Subunits Bchi And Bchd Of
Magnesium Chelatase Based On Single-Particle Cryo-Em
Reconstruction At 7.5 Ang
pdb|2X31|J Chain J, Modelling Of The Complex Between Subunits Bchi And Bchd Of
Magnesium Chelatase Based On Single-Particle Cryo-Em
Reconstruction At 7.5 Ang
pdb|2X31|K Chain K, Modelling Of The Complex Between Subunits Bchi And Bchd Of
Magnesium Chelatase Based On Single-Particle Cryo-Em
Reconstruction At 7.5 Ang
pdb|2X31|L Chain L, Modelling Of The Complex Between Subunits Bchi And Bchd Of
Magnesium Chelatase Based On Single-Particle Cryo-Em
Reconstruction At 7.5 Ang
Length = 350
Score = 31.6 bits (70), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 12/25 (48%), Positives = 18/25 (72%)
Query: 366 RQLHPKHKVPSNAVWLCAAICIILG 390
R+ PK + P+ A++ CAA+CI LG
Sbjct: 260 RERLPKVEAPNTALYDCAALCIALG 284
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.140 0.466
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,530,121
Number of Sequences: 62578
Number of extensions: 637062
Number of successful extensions: 1352
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1351
Number of HSP's gapped (non-prelim): 8
length of query: 512
length of database: 14,973,337
effective HSP length: 103
effective length of query: 409
effective length of database: 8,527,803
effective search space: 3487871427
effective search space used: 3487871427
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)