BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010352
         (512 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1MBM|A Chain A, Nsp4 Proteinase From Equine Arteritis Virus
 pdb|1MBM|B Chain B, Nsp4 Proteinase From Equine Arteritis Virus
 pdb|1MBM|C Chain C, Nsp4 Proteinase From Equine Arteritis Virus
 pdb|1MBM|D Chain D, Nsp4 Proteinase From Equine Arteritis Virus
          Length = 198

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 93  HLASPKWGPFASWCCAWLETIGLIAGM-----GTQAYAGSQTLQ--SIILLCTGTNKDG 144
           H A P  GP ASWC A  +  GL++G       T   +GS  +Q  +++ + TG+N  G
Sbjct: 78  HFAQPTTGP-ASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSG 135


>pdb|1G8P|A Chain A, Crystal Structure Of Bchi Subunit Of Magnesium Chelatase
 pdb|2X31|G Chain G, Modelling Of The Complex Between Subunits Bchi And Bchd Of
           Magnesium Chelatase Based On Single-Particle Cryo-Em
           Reconstruction At 7.5 Ang
 pdb|2X31|H Chain H, Modelling Of The Complex Between Subunits Bchi And Bchd Of
           Magnesium Chelatase Based On Single-Particle Cryo-Em
           Reconstruction At 7.5 Ang
 pdb|2X31|I Chain I, Modelling Of The Complex Between Subunits Bchi And Bchd Of
           Magnesium Chelatase Based On Single-Particle Cryo-Em
           Reconstruction At 7.5 Ang
 pdb|2X31|J Chain J, Modelling Of The Complex Between Subunits Bchi And Bchd Of
           Magnesium Chelatase Based On Single-Particle Cryo-Em
           Reconstruction At 7.5 Ang
 pdb|2X31|K Chain K, Modelling Of The Complex Between Subunits Bchi And Bchd Of
           Magnesium Chelatase Based On Single-Particle Cryo-Em
           Reconstruction At 7.5 Ang
 pdb|2X31|L Chain L, Modelling Of The Complex Between Subunits Bchi And Bchd Of
           Magnesium Chelatase Based On Single-Particle Cryo-Em
           Reconstruction At 7.5 Ang
          Length = 350

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 366 RQLHPKHKVPSNAVWLCAAICIILG 390
           R+  PK + P+ A++ CAA+CI LG
Sbjct: 260 RERLPKVEAPNTALYDCAALCIALG 284


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.140    0.466 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,530,121
Number of Sequences: 62578
Number of extensions: 637062
Number of successful extensions: 1352
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1351
Number of HSP's gapped (non-prelim): 8
length of query: 512
length of database: 14,973,337
effective HSP length: 103
effective length of query: 409
effective length of database: 8,527,803
effective search space: 3487871427
effective search space used: 3487871427
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)