Citrus Sinensis ID: 010400


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-
MAQDAGMFTVPQTVGSVLCCKCGIPMAPNAANMCVACLRSEVDITEGLQKHVIISHCPECDCYLQPPRTWIKAQLESKELLTFCVKRLKNLNRVRLVNAEFIWTEPHSKRIKVKLKVQKEVLNGAILEQSYVVEYVQQDHMCDSCSRVQANPDQWVAAVQLRQHVTHRRTFFYLEQLILKHDAAARAIRITQMDQGIDFFFGNRSHAVKFVEFVGKVAPVRSRHDKQLVSHDPKSNNFNYKYTFSVEISPICREDLICLPPKVAVSLGNLGPLVICMKVTNSIALLDPFTLRHCFLDADQYWRSSFKSLLTSRQLVEYIVLDVEVVSSEVNVGGSKYVLADAQVARVSDFGKNDTIFSIRTHLGHLLNPGDYALGYDLYSANNNDMELDKYKGLVLPETILIKKSYEEKRLRKRSKPRSWKLKSLDMEVDDSKGRTDQEKMNKEYEEFLRDLEENPELRFNISLYRNKDYQPSEMASVTDGEDVPSVPLDELLADLDLKSDDGEGDDSMRE
cccccccccccccccEEEEcccccccccccccccHHHHccccccccccccEEEEEEccccccCCcccccEEEccccHHHHHHHHHHHcccccccEEEcccEEEEcccccEEEEEEEEEEEEEccEEEEEEEEEEEEEEccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEcccCEEEEccHHHHHHHHHHHHccccEEECcccEEEEcccccccEEEEEEEEEEEcccccccEEECcHHHHHHccccccEEEEEEECcEEEEEcccccEEEECccccccccccccccccccEEEEEEEEEEEEccccccccccEEEEEEEEEEEccccccccEEEEEEccccccccccccccccccccccccHHHHHccccccccEEEEEcccHHHHHHHcccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHccHHHHcccccECccccccccccccccccccccccHHHHccccccccccccccccccc
***********QTVGSVLCCKCGIPMAPNAANMCVACLRSEVDITEGLQKHVIISHCPECDCYLQPPRTWIKAQLESKELLTFCVKRLKNLNRVRLVNAEFIWTEPHSKRIKVKLKVQKEVLNGAILEQSYVVEYVQQDHMCDSCSRVQANPDQWVAAVQLRQHVTHRRTFFYLEQLILKHDAAARAIRITQMDQGIDFFFGNRSHAVKFVEFVGKVAPVRSRHDKQL*SHDPKSNNFNYKYTFSVEISPICREDLICLPPKVAVSLGNLGPLVICMKVTNSIALLDPFTLRHCFLDADQYWRSSFKSLLTSRQLVEYIVLDVEVVSSEVNVGGSKYVLADAQVARVSDFGKNDTIFSIRTHLGHLLNPGDYALGYDLYSANNNDMELDKYKGLVLPETILIKK***************WKLK********************EYEEFLRDLEENPELRFNISLYRN******************SVPLDELLADLDL*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQDAGMFTVPQTVGSVLCCKCGIPMAPNAANMCVACLRSEVDITEGLQKHVIISHCPECDCYLQPPRTWIKAQLESKELLTFCVKRLKNLNRVRLVNAEFIWTEPHSKRIKVKLKVQKEVLNGAILEQSYVVEYVQQDHMCDSCSRVQANPDQWVAAVQLRQHVTHRRTFFYLEQLILKHDAAARAIRITQMDQGIDFFFGNRSHAVKFVEFVGKVAPVRSRHDKQLVSHDPKSNNFNYKYTFSVEISPICREDLICLPPKVAVSLGNLGPLVICMKVTNSIALLDPFTLRHCFLDADQYWRSSFKSLLTSRQLVEYIVLDVEVVSSEVNVGGSKYVLADAQVARVSDFGKNDTIFSIRTHLGHLLNPGDYALGYDLYSANNNDMELDKYKGLVLPETILIKKSYEEKRLRKRSKPRSWKLKSLDMEVDDSKGxxxxxxxxxxxxxxxxxxxxxPELRFNISLYRNKDYQPSEMASVTDGEDVPSVPLDELLADLDLKSDDGEGDDSMRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal export protein NMD3 Acts as an adapter for the XPO1/CRM1-mediated export of the 60S ribosomal subunit.probableQ5BLF0
60S ribosomal export protein NMD3 Acts as an adapter for the XPO1/CRM1-mediated export of the 60S ribosomal subunit.probableQ99L48
60S ribosomal export protein NMD3 Acts as an adapter for the XPO1/CRM1-mediated export of the 60S ribosomal subunit.probableQ5RC82

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 23-69
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 397-455
View the alignment between query and template
View the model in PyMOL
Template: 2EIF, chain A
Confidence level:probable
Coverage over the Query: 243-264
View the alignment between query and template
View the model in PyMOL