BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 010405
(511 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3S6B|A Chain A, Crystal Structure Of Methionine Aminopeptidase 1b From
Plasmodium Falciparum, Pf10_0150
Length = 368
Score = 30.8 bits (68), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 15/69 (21%)
Query: 349 SNIYVETLKGENAEEV----------RKTMRKRKIKRAPGCSLIELDGVVHEFLAGDRSH 398
S+IYV N EE+ RKT+ +PG + E+D VHEF+ + ++
Sbjct: 99 SDIYVN-----NEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAY 153
Query: 399 EKTQEIYQF 407
T Y+F
Sbjct: 154 PSTLNYYKF 162
>pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate
Reductase- Thymidylate Synthase
pdb|2H2Q|B Chain B, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate
Reductase- Thymidylate Synthase
pdb|3CL9|A Chain A, Structure Of Bifunctional Tcdhfr-Ts In Complex With Mtx
pdb|3CLB|A Chain A, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
pdb|3CLB|B Chain B, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
pdb|3CLB|C Chain C, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
pdb|3CLB|D Chain D, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
pdb|3HBB|A Chain A, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
Of Trypanosoma Cruzi In The Folate-Free State And In
Complex With Two Antifolate Drugs, Trimetrexate And
Methotrexate
pdb|3HBB|B Chain B, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
Of Trypanosoma Cruzi In The Folate-Free State And In
Complex With Two Antifolate Drugs, Trimetrexate And
Methotrexate
pdb|3HBB|C Chain C, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
Of Trypanosoma Cruzi In The Folate-Free State And In
Complex With Two Antifolate Drugs, Trimetrexate And
Methotrexate
pdb|3HBB|D Chain D, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
Of Trypanosoma Cruzi In The Folate-Free State And In
Complex With Two Antifolate Drugs, Trimetrexate And
Methotrexate
pdb|3KJS|A Chain A, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
D Inhibitors: Dq1 Inhibitor Complex
pdb|3KJS|B Chain B, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
D Inhibitors: Dq1 Inhibitor Complex
pdb|3KJS|C Chain C, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
D Inhibitors: Dq1 Inhibitor Complex
pdb|3KJS|D Chain D, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
D Inhibitors: Dq1 Inhibitor Complex
Length = 521
Score = 29.6 bits (65), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 7/68 (10%)
Query: 447 LALAFGLICTKPGSVIRIVKNIRICSD----CHSAMKLVSKVFKRKISIRDRKHYHHFED 502
+A A GL +PG ++ + + + S+ C+ +K V + F + R+R+ +E+
Sbjct: 445 IAKATGL---RPGELVHTLGDAHVYSNHVEPCNEQLKRVPRAFPYLVFRREREFLEDYEE 501
Query: 503 GSCSCLEY 510
G ++Y
Sbjct: 502 GDMEVIDY 509
>pdb|3INV|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph, Dump And C-448 Antifolate
pdb|3INV|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph, Dump And C-448 Antifolate
pdb|3IRM|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Cycloguanil
pdb|3IRM|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Cycloguanil
pdb|3IRM|C Chain C, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Cycloguanil
pdb|3IRM|D Chain D, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Cycloguanil
pdb|3IRN|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Cycloguanil
pdb|3IRN|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Cycloguanil
pdb|3IRN|C Chain C, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Cycloguanil
pdb|3IRN|D Chain D, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Cycloguanil
pdb|3IRO|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Q-8 Antifolate
pdb|3IRO|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Q-8 Antifolate
pdb|3IRO|C Chain C, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Q-8 Antifolate
pdb|3IRO|D Chain D, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
Synthase Complexed With Nadph And Q-8 Antifolate
Length = 521
Score = 29.6 bits (65), Expect = 4.5, Method: Compositional matrix adjust.
Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 7/68 (10%)
Query: 447 LALAFGLICTKPGSVIRIVKNIRICSD----CHSAMKLVSKVFKRKISIRDRKHYHHFED 502
+A A GL +PG ++ + + + S+ C+ +K V + F + R+R+ +E+
Sbjct: 445 IAKATGL---RPGELVHTLGDAHVYSNHVEPCNEQLKRVPRAFPYLVFRREREFLEDYEE 501
Query: 503 GSCSCLEY 510
G ++Y
Sbjct: 502 GDMEVIDY 509
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.137 0.421
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,248,377
Number of Sequences: 62578
Number of extensions: 612440
Number of successful extensions: 1441
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1438
Number of HSP's gapped (non-prelim): 9
length of query: 511
length of database: 14,973,337
effective HSP length: 103
effective length of query: 408
effective length of database: 8,527,803
effective search space: 3479343624
effective search space used: 3479343624
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)