BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 010405
         (511 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3S6B|A Chain A, Crystal Structure Of Methionine Aminopeptidase 1b From
           Plasmodium Falciparum, Pf10_0150
          Length = 368

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 15/69 (21%)

Query: 349 SNIYVETLKGENAEEV----------RKTMRKRKIKRAPGCSLIELDGVVHEFLAGDRSH 398
           S+IYV      N EE+          RKT+       +PG +  E+D  VHEF+  + ++
Sbjct: 99  SDIYVN-----NEEEIQRIREACILGRKTLDYAHTLVSPGVTTDEIDRKVHEFIIKNNAY 153

Query: 399 EKTQEIYQF 407
             T   Y+F
Sbjct: 154 PSTLNYYKF 162


>pdb|2H2Q|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate
           Reductase- Thymidylate Synthase
 pdb|2H2Q|B Chain B, Crystal Structure Of Trypanosoma Cruzi Dihydrofolate
           Reductase- Thymidylate Synthase
 pdb|3CL9|A Chain A, Structure Of Bifunctional Tcdhfr-Ts In Complex With Mtx
 pdb|3CLB|A Chain A, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
 pdb|3CLB|B Chain B, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
 pdb|3CLB|C Chain C, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
 pdb|3CLB|D Chain D, Structure Of Bifunctional Tcdhfr-Ts In Complex With Tmq
 pdb|3HBB|A Chain A, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
           Of Trypanosoma Cruzi In The Folate-Free State And In
           Complex With Two Antifolate Drugs, Trimetrexate And
           Methotrexate
 pdb|3HBB|B Chain B, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
           Of Trypanosoma Cruzi In The Folate-Free State And In
           Complex With Two Antifolate Drugs, Trimetrexate And
           Methotrexate
 pdb|3HBB|C Chain C, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
           Of Trypanosoma Cruzi In The Folate-Free State And In
           Complex With Two Antifolate Drugs, Trimetrexate And
           Methotrexate
 pdb|3HBB|D Chain D, Structures Of Dihydrofolate Reductase-Thymidylate Synthase
           Of Trypanosoma Cruzi In The Folate-Free State And In
           Complex With Two Antifolate Drugs, Trimetrexate And
           Methotrexate
 pdb|3KJS|A Chain A, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
           D Inhibitors: Dq1 Inhibitor Complex
 pdb|3KJS|B Chain B, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
           D Inhibitors: Dq1 Inhibitor Complex
 pdb|3KJS|C Chain C, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
           D Inhibitors: Dq1 Inhibitor Complex
 pdb|3KJS|D Chain D, Crystal Structure Of T. Cruzi Dhfr-Ts With 3 High Affinity
           D Inhibitors: Dq1 Inhibitor Complex
          Length = 521

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 447 LALAFGLICTKPGSVIRIVKNIRICSD----CHSAMKLVSKVFKRKISIRDRKHYHHFED 502
           +A A GL   +PG ++  + +  + S+    C+  +K V + F   +  R+R+    +E+
Sbjct: 445 IAKATGL---RPGELVHTLGDAHVYSNHVEPCNEQLKRVPRAFPYLVFRREREFLEDYEE 501

Query: 503 GSCSCLEY 510
           G    ++Y
Sbjct: 502 GDMEVIDY 509


>pdb|3INV|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph, Dump And C-448 Antifolate
 pdb|3INV|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph, Dump And C-448 Antifolate
 pdb|3IRM|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Cycloguanil
 pdb|3IRM|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Cycloguanil
 pdb|3IRM|C Chain C, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Cycloguanil
 pdb|3IRM|D Chain D, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Cycloguanil
 pdb|3IRN|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Cycloguanil
 pdb|3IRN|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Cycloguanil
 pdb|3IRN|C Chain C, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Cycloguanil
 pdb|3IRN|D Chain D, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Cycloguanil
 pdb|3IRO|A Chain A, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Q-8 Antifolate
 pdb|3IRO|B Chain B, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Q-8 Antifolate
 pdb|3IRO|C Chain C, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Q-8 Antifolate
 pdb|3IRO|D Chain D, Trypanosoma Cruzi Dihydrofolate Reductase-Thymidylate
           Synthase Complexed With Nadph And Q-8 Antifolate
          Length = 521

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 447 LALAFGLICTKPGSVIRIVKNIRICSD----CHSAMKLVSKVFKRKISIRDRKHYHHFED 502
           +A A GL   +PG ++  + +  + S+    C+  +K V + F   +  R+R+    +E+
Sbjct: 445 IAKATGL---RPGELVHTLGDAHVYSNHVEPCNEQLKRVPRAFPYLVFRREREFLEDYEE 501

Query: 503 GSCSCLEY 510
           G    ++Y
Sbjct: 502 GDMEVIDY 509


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.421 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,248,377
Number of Sequences: 62578
Number of extensions: 612440
Number of successful extensions: 1441
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1438
Number of HSP's gapped (non-prelim): 9
length of query: 511
length of database: 14,973,337
effective HSP length: 103
effective length of query: 408
effective length of database: 8,527,803
effective search space: 3479343624
effective search space used: 3479343624
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)